KEGG   Danio rerio (zebrafish): 541325Help
Entry
541325            CDS       T01004                                 

Gene name
ccnh, zgc:114132
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
dre  Danio rerio (zebrafish)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dre03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dre03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:dre04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 319 aa AA seqDB search
MYHNSSQKKFWTYDKEETLDKLRLEANQKFCSKALSSGKPGINESTLLNEQEEKVLFKHY
EKRLLDFCAVFKPVMPKSVVGTACMYFRRFYLNNSLMEYHPRTIMLTCAYLSCKVDEFNV
SSTQFVGNLQESPAGQERAVDQILEYELLLIQQLNFHLVVHNPYRPLEGFLIDLKTRYPL
LENPEMLRKSAEDFLNRATMTDAGLLFSPSQIALTAVLNSAARAGLKMDVYLNECMGLKE
DKETLSKMYESMRRMTSLVKAYELPKAEEVSICKQKLERIYAEFATNLKRKHGYEDDDHI
VKRQMVADEEWTDDDLDAL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacaacagctcacagaagaaattctggacatatgataaagaggaaactttggat
aaattaagacttgaagctaatcagaagttctgctcaaaagctctgtccagtggaaagcct
ggaataaatgaatccacacttctcaatgagcaggaagagaaagtgcttttcaaacactat
gagaagagattgctagacttttgtgctgtgtttaagcctgtgatgcctaaatctgttgtg
ggcacagcttgcatgtattttcgaagattctatttgaacaactcattaatggagtatcat
cctcggacaataatgttgacatgtgcatatctgtcctgtaaagtggatgagtttaatgtg
tccagcactcagtttgtggggaatcttcaggagagcccagcgggacaggagagagctgta
gatcagattctggagtatgaactgctccttatccagcagctgaattttcatctggtcgtt
cacaatccgtatcgacctttggagggttttctgattgatctgaagaccaggtacccattg
ttagagaacccagagatgcttagaaaaagtgctgaagactttctcaaccgagcaacaatg
acagatgccggactgctcttctctccatctcagattgctctcactgctgtcctcaatagc
gctgcacgtgctggcctcaagatggatgtatatttaaatgaatgtatggggcttaaggag
gataaagagaccctctcaaagatgtacgagtcaatgagacgaatgacaagtcttgttaaa
gcgtacgagcttcccaaagctgaggaagtcagtatctgcaaacagaaactggaaaggatt
tatgctgagtttgctacaaacctgaaaagaaaacatggatatgaagatgacgatcacatt
gtgaaaaggcagatggttgcagatgaagagtggactgatgatgatttggatgcattgtga

DBGET integrated database retrieval system