KEGG   Danio rerio (zebrafish): 541325Help
Entry
541325            CDS       T01004                                 

Gene name
ccnh, zgc:114132
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
dre  Danio rerio (zebrafish)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    541325 (ccnh)
  Replication and repair
   03420 Nucleotide excision repair
    541325 (ccnh)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    541325 (ccnh)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     541325 (ccnh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 319 aa AA seqDB search
MYHNSSQKKFWTYDKEETLDKLRLEANQKFCSKALSSGKPGINESTLLNEQEEKVLFKHY
EKRLLDFCAVFKPVMPKSVVGTACMYFRRFYLNNSLMEYHPRTIMLTCAYLSCKVDEFNV
SSTQFVGNLQESPAGQERAVDQILEYELLLIQQLNFHLVVHNPYRPLEGFLIDLKTRYPL
LENPEMLRKSAEDFLNRATMTDAGLLFSPSQIALTAVLNSAARAGLKMDVYLNECMGLKE
DKETLSKMYESMRRMTSLVKAYELPKAEEVSICKQKLERIYAEFATNLKRKHGYEDDDHI
VKRQMVADEEWTDDDLDAL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacaacagctcacagaagaaattctggacatatgataaagaggaaactttggat
aaattaagacttgaagctaatcagaagttctgctcaaaagctctgtccagtggaaagcct
ggaataaatgaatccacacttctcaatgagcaggaagagaaagtgcttttcaaacactat
gagaagagattgctagacttttgtgctgtgtttaagcctgtgatgcctaaatctgttgtg
ggcacagcttgcatgtattttcgaagattctatttgaacaactcattaatggagtatcat
cctcggacaataatgttgacatgtgcatatctgtcctgtaaagtggatgagtttaatgtg
tccagcactcagtttgtggggaatcttcaggagagcccagcgggacaggagagagctgta
gatcagattctggagtatgaactgctccttatccagcagctgaattttcatctggtcgtt
cacaatccgtatcgacctttggagggttttctgattgatctgaagaccaggtacccattg
ttagagaacccagagatgcttagaaaaagtgctgaagactttctcaaccgagcaacaatg
acagatgccggactgctcttctctccatctcagattgctctcactgctgtcctcaatagc
gctgcacgtgctggcctcaagatggatgtatatttaaatgaatgtatggggcttaaggag
gataaagagaccctctcaaagatgtacgagtcaatgagacgaatgacaagtcttgttaaa
gcgtacgagcttcccaaagctgaggaagtcagtatctgcaaacagaaactggaaaggatt
tatgctgagtttgctacaaacctgaaaagaaaacatggatatgaagatgacgatcacatt
gtgaaaaggcagatggttgcagatgaagagtggactgatgatgatttggatgcattgtga

DBGET integrated database retrieval system