KEGG   Danio rerio (zebrafish): 541370Help
Entry
541370            CDS       T01004                                 

Gene name
gnb2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    541370 (gnb2)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   541370 (gnb2)
GTP-binding proteins [BR:dre04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    541370 (gnb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A CALM_bind
Motif
Other DBs
NCBI-GeneID: 541370
NCBI-ProteinID: NP_001013515
ZFIN: ZDB-GENE-050320-65
Ensembl: ENSDARG00000035357
Vega: OTTDARG00000018049
UniProt: Q5BJ11
Position
5
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKIHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFIDDNQIITSSGDTTCALWDIETGQQTTLF
SGHSGDVMSLSLAPDSRTFISGACDASIKLWDIRDSMCRQTFTGHESDINAACFFPSGSA
FATGSDDATCRLFDLRADQELCLYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGERAGVLAGHDNRVSCLGVTDDGMAVCTGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctcgagcagcttcgtcaggaggctgagcaactgcgcaatcagatcagagat
gccaggaaagcatgcggagactccacacttacacagataacagcaggtctggacccagtg
gggaggatacagatgaggacgaggcgcacactgcggggccatttggccaaaatctacgcc
atgcactggggcacagactccaggcttcttgttagtgcctcacaggatggaaaactcatc
atctgggacagttatactacaaacaagattcatgccatcccgctgcggtcctcatgggtg
atgacatgtgcatatgcgccatctgggaactttgtggcctgtggtggactggacaacatt
tgctccatatacagcctgaagacgagagagggcaatgtgagagtgagccgagagctgcct
ggacacacaggttacctatcctgttgccgtttcatagatgacaatcagataatcaccagt
tcaggagacacaacctgtgctctgtgggacattgagacaggtcagcagaccacgctgttc
tctggccacagtggagatgtcatgagtctctctcttgctccagactctcgcaccttcatc
tccggggcctgcgatgcctccattaaactctgggacatcagagacagcatgtgcagacag
accttcaccggccacgagtccgacatcaacgccgcctgcttcttccccagcggcagtgct
tttgcgacgggttcggatgacgccacctgcaggctgtttgacctgcgtgcggatcaggag
ctgtgtttgtactctcacgataatatcatctgtggcatcacctctgtggccttctctcgc
tccggacgcctgctgctcgccggatacgacgacttcaattgcaacatctgggatgccatg
aagggagagcgagcaggagtgctggctggccatgacaatcgtgtgagctgtctgggagta
acagatgatggcatggccgtgtgcacaggatcctgggacagtttcctgaagatctggaac
tga

DBGET integrated database retrieval system