KEGG   Danio rerio (zebrafish): 541370Help
Entry
541370            CDS       T01004                                 

Gene name
gnb2, im:7138539, zgc:113357
Definition
guanine nucleotide binding protein (G protein), beta polypeptide 2
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
dre  Danio rerio (zebrafish)
Brite
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   541370 (gnb2)
GTP-binding proteins [BR:dre04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    541370 (gnb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKIHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFIDDNQIITSSGDTTCALWDIETGQQTTLF
SGHSGDVMSLSLAPDSRTFISGACDASIKLWDIRDSMCRQTFTGHESDINAACFFPSGSA
FATGSDDATCRLFDLRADQELCLYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGERAGVLAGHDNRVSCLGVTDDGMAVCTGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctcgagcagcttcgtcaggaggctgagcaactgcgcaatcagatcagagat
gccaggaaagcatgcggagactccacacttacacagataacagcaggtctggacccagtg
gggaggatacagatgaggacgaggcgcacactgcggggccatttggccaaaatctacgcc
atgcactggggcacagactccaggcttcttgttagtgcctcacaggatggaaaactcatc
atctgggacagttatactacaaacaagattcatgccatcccgctgcggtcctcatgggtg
atgacatgtgcatatgcgccatctgggaactttgtggcctgtggtggactggacaacatt
tgctccatatacagcctgaagacgagagagggcaatgtgagagtgagccgagagctgcct
ggacacacaggttacctatcctgttgccgtttcatagatgacaatcagataatcaccagt
tcaggagacacaacctgtgctctgtgggacattgagacaggtcagcagaccacgctgttc
tctggccacagtggagatgtcatgagtctctctcttgctccagactctcgcaccttcatc
tccggggcctgcgatgcctccattaaactctgggacatcagagacagcatgtgcagacag
accttcaccggccacgagtccgacatcaacgccgcctgcttcttccccagcggcagtgct
tttgcgacgggttcggatgacgccacctgcaggctgtttgacctgcgtgcggatcaggag
ctgtgtttgtactctcacgataatatcatctgtggcatcacctctgtggccttctctcgc
tccggacgcctgctgctcgccggatacgacgacttcaattgcaacatctgggatgccatg
aagggagagcgagcaggagtgctggctggccatgacaatcgtgtgagctgtctgggagta
acagatgatggcatggccgtgtgcacaggatcctgggacagtttcctgaagatctggaac
tga

DBGET integrated database retrieval system