KEGG   Danio rerio (zebrafish): 544664Help
Entry
544664            CDS       T01004                                 

Gene name
erbb3b, erbb3
Definition
v-erb-b2 erythroblastic leukemia viral oncogene homolog 3b
Orthology
K05084  
receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
ErbB signaling pathway
Calcium signaling pathway
Endocytosis
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:dre04012]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:dre04020]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dre04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 1429 aa AA seqDB search
MGQQVLALCALLFLCVPQPVTSQTQEVCTGTKNALSSTGTPEQHYNNLKERYTGCEIVMG
NLEITQMENDLDFSFLGSIREVTGYILIAMNQFRKLPLNQLRVIRGSSLYDKEWALSVFH
NFDTHTGLEDLGLTNLTEILEGGVQIVHNRNLSYAPLINWQDIVRDGDARIQIQDNGGRG
SCNPACGEFCWGPSNDQCQKLTKTVCALQCLGHCFGTNPNECCHPECAGGCTGPRDTDCF
ACRHVNYSGSCVPHCPWPVVYNQQTFQVEPNADAMYQFGSICVPKCPGHFVVDGSACVSS
CPPGKTEIEKNQIKQCETCIGLCPKVCEGTGANHRQTVDSSNIDSFINCTKIQGSLHFLI
LGIKGDVYNNIPPLEPEKLKVFNTVREITGILNIQSWPDELHDLSVFSSLTTIQGRSLYN
PNTPFSMLMMKIPSLTSLGLRSMREISDGSVYITQNMNLCYHHTINWTQIFPRNQLQRRR
NDIKENKQKIQCEEEGHVCDPLCSDAGCWGPGPEQCLSCRNYSRLGTCVSHCNLYSGEPR
EFAASNKECLACHSECLLQNGKQTCLGKGADQCVACSNLMDGPHCVSSCPNGVNGEKGQT
IFKYSTAAGHCELCHFNCTRGCTGPALRDCVDPDRNVNSSQIAGIAVAVFAGITVLLALF
VLGMLYHRGLAIRRKRALRRYLESGESMEPLDPGEKGTKVHARILKPQELRKGKLLGYGV
FGTVNKGFWIPEGDSLKIPVAIKTIQNRSSRQTFTEITDHMLSMGSLDHPYIVRLIGICP
GASLQLITQLSPHGSLLQHLRQHKDSLDPQRLLNWCVQIAKGMYYLEEHCMAHRNLAARN
ILLKSDYIVQISDFGVADLLYPDDKKYVYSEHKTSIKWMALESILFGRYTHQSDVWSYGV
TVWEMMSYGAEPYASMHPHDVPGLLEKGERLAQPQICTIDVYMVMVKCWMIDENVRPTFK
ELASEFTRMARDPPRYLVVRPAQNGGGAEESQRYVKSSHLEVGLEEEDDDEDEGLQVGFA
TPPLQLSPTRSHSRVRIASYKSTSEHTAPIGYLPMTPGPGDEPRQLRAQRRKTGSVRTES
ECSEGRGTIVDIEAVEITSQTGSLRRGRSRMDSAYISGGVSVASDPFSSGLEGVDEDHYG
YVLPTERDFRSAVPHGRTSRNSKSTPKTDATQEYELMNKQTNKLSSSPTDSTDHLKPASL
VSAHICSSLPQKKEMDSAQTQDEILPQKRETDSTQSQENNLPQKSETDSTQTQESEKDAS
FQPDNFESAENCLIGSETLNDGGQSEEEEQQPRLAMVEYEYMDIRTDEHQQNVAGKRTTN
GPNEVEREAIYQNISQPLRFHENPDSAGNTMQRRGEYVDMEASGRSGCEVGDYQNVPVKG
RPVVGEESQNTGLRSYIKVCAGVEPQNTSFDNPDYWHSRLFHKQDTVCT
NT seq 4290 nt NT seq  +upstreamnt  +downstreamnt
atgggacagcaggtgctcgcgctctgcgctctcctgttcctctgtgtacctcagcctgtc
acttcacaaacacaagaagtttgcactggcaccaaaaatgctctgagctccacgggcacc
ccagaacagcactacaacaaccttaaagagcgctacaccggatgtgagatcgtcatgggc
aatcttgagattacacagatggagaatgacctcgatttctcctttcttggaagtatccga
gaggtcaccggctacatcctcattgcgatgaaccagtttcgcaagttacctttgaatcag
ctccgagtgattcgtggcagcagcttgtatgacaaagaatgggctctttctgtctttcat
aactttgacactcacactggcctggaagatctgggcctcaccaacctcacagagatcttg
gaaggtggagtacagattgtccacaacaggaacctcagctatgctccattgatcaactgg
caggacattgtcagagacggtgacgctcgcatccagatccaggacaatggaggaagaggg
tcctgcaatcctgcatgtggagagttttgctggggtccaagtaatgatcagtgtcagaaa
ttgactaaaacagtatgtgcacttcagtgtctgggccactgtttcggcaccaaccctaat
gaatgctgccaccccgagtgtgctggaggctgcactggacccagggacacagactgcttt
gcctgtcgacatgtcaattactctggctcctgcgtccctcactgcccttggcctgtggtc
tacaaccaacagacctttcaggtggagcccaatgctgatgccatgtatcagttcggttcc
atctgtgttcctaaatgtcccgggcactttgttgtggatggcagtgcatgcgtgagcagt
tgtcctcccggtaaaacagaaatagagaagaatcaaattaaacagtgtgagacctgcatt
ggcctgtgtcccaaagtatgtgagggaactggagccaatcacagacagacagtggactcc
agtaacattgacagctttatcaattgtaccaagatccaaggaagtctacattttctgatc
ttaggtatcaaaggagacgtctataataacataccacctctggagcctgaaaaactcaaa
gtgtttaacacagtcagagaaattactggtattttgaacattcagtcttggcccgatgaa
ctccatgatctatctgttttctctagtctcactaccattcagggaagatctctgtacaat
cctaacacgccattctctatgttgatgatgaagattccctccctcacatctctaggactg
cgctccatgagggagatcagcgacggcagtgtatacatcactcaaaatatgaacctgtgt
tatcaccacaccatcaactggacacagatcttcccacgtaaccaattgcaacgcagacgt
aacgacatcaaggaaaacaaacaaaagatccagtgtgaggaagagggccatgtgtgcgac
ccgttgtgttcagacgcaggatgttggggcccggggcctgagcagtgtttgtcatgcagg
aactacagtcggctcggcacctgtgtgtctcactgtaacctctactccggagagccgcgg
gagtttgcagcatctaataaggagtgtcttgcttgtcactcagagtgtctgttgcagaat
gggaaacaaacatgcctaggaaaaggtgcagatcagtgtgtagcgtgttcaaacctgatg
gacggccctcactgtgtttcttcttgtcctaatggagtgaatggagaaaaggggcagacc
atatttaaatactccactgcagcgggtcattgtgagctctgtcacttcaactgcacacga
ggatgtacaggccctgcgttgagagactgtgttgatcctgacagaaatgtgaacagctct
cagattgcaggtatagcagttgccgtgtttgctggtattactgtgcttctggcgctgttt
gtgcttggtatgctgtatcacagaggcttggccattcgccgcaaaagagcactgagaaga
tatctagagagtggtgagagcatggagccgctggatccaggagagaaggggacaaaagtg
catgcccgcatcctaaaaccacaggagctgcgaaagggcaaacttctgggctacggagtc
tttggcaccgtcaataagggtttttggattcctgaaggtgactccctaaaaatccctgtg
gccataaagaccatccagaaccgcagcagtcggcagaccttcacagagatcactgatcat
atgctttcaatgggaagcctggatcacccgtatatagtgcgtctcattgggatctgccct
ggggccagtttgcagttgatcacgcagctcagtcctcatggatcattacttcaacacctt
cgccagcacaaagacagcctggaccctcagcggctgctcaactggtgtgtgcagatcgct
aagggcatgtattatctggaggagcactgcatggcccataggaacctggctgcacgaaac
atactgctcaagagtgactacatagtacagatctcggactttggggttgcagatctgctc
tatccagatgataagaaatatgtgtacagtgaacacaagacatcaataaaatggatggca
ttagagagcatcctcttcggcagatacactcatcagagtgacgtgtggagctacggtgtg
acggtatgggagatgatgtcatacggagcggagccatacgcttctatgcatcctcatgat
gtgccgggtctgctggagaaaggagagcgtctggctcaacctcagatctgcaccatagac
gtctacatggtcatggtcaagtgctggatgattgatgaaaatgtgagacccacatttaaa
gaactagccagtgaatttacaagaatggcaagggacccgccacgctaccttgtggtgagg
cctgctcagaatggcggcggtgcagaggaaagccagcggtatgttaaaagctctcatcta
gaggtaggattggaagaggaggacgatgatgaagatgaagggttgcaggttgggtttgcg
actcctcctctccagctctcacctactagaagtcattcccgtgtccggattgcctcctac
aagagcacctcagaacacacagcaccgataggttatctccccatgaccccaggcccagga
gatgagcctagacagttgcgagcccagaggaggaagactggctcagtgaggacagagtct
gagtgttcggagggccgggggaccattgtggacattgaagcagttgaaatcacttctcaa
acaggcagtcttcgcagaggacgcagtcgaatggacagtgcttacatatctggcggagtg
tctgtcgcatcagatccattctcttctggtctggaaggagtagatgaagaccattatgga
tacgtgctgcctaccgaaagagatttcagaagtgctgttcctcatggtaggacatccaga
aactccaaaagcactccaaaaacagatgccacgcaagagtacgagctaatgaacaaacag
acaaacaaactttcctcctcgcccacagacagcactgaccatttaaaaccagcatccctt
gtttctgcacacatatgtagcagtttacctcagaaaaaagaaatggactcagcacaaacc
caagatgaaattttaccacagaaaagagaaacagactcaacacaaagccaagagaacaat
ttaccacagaaaagtgaaacggactcaactcaaacccaagagtcagagaaggatgctagt
tttcaacctgacaactttgagtctgctgaaaactgtctgattggatcggaaacattaaac
gatggtggtcaatctgaagaggaagaacagcagccacgattggcgatggtcgaatatgaa
tacatggacatacgtacagatgaacaccaacaaaatgtagctggcaaacgtacaacaaac
ggtccaaatgaggtggagagggaagcaatttatcaaaatataagtcaacctctaagattt
catgaaaatccagattctgctggcaatacgatgcagaggcgcggtgaatatgtggacatg
gaggcatctgggagaagtggctgtgaggttggagattatcagaatgtcccggtaaaggga
aggcctgttgtgggagaggagtcgcaaaatactggcctcagatcttacataaaagtgtgt
gctggagtggagccgcaaaacacttcttttgacaacccagattactggcacagcagactt
ttccacaagcaggacaccgtgtgcacatga

DBGET integrated database retrieval system