KEGG   Danio rerio (zebrafish): 550455Help
Entry
550455            CDS       T01004                                 

Gene name
mrps18b, wu:fj45h02, zgc:112517
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dre  Danio rerio (zebrafish)
Brite
Ribosome [BR:dre03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    550455 (mrps18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 242 aa AA seqDB search
MAASLQRIGIVACRTFPVNLQRHLQAQRIRDVRITSIVAPVHRVNYCASSSSADNTNSAE
TLSRYADTPWEYLKSEEYIERYGTKPVWTNYRRNHKGGIPPQKTRKTCIRGDKKCANPCP
ICRDPNIIIHYKNVNLLQQFFCPETGVVHDPTVTGVCMKQQKLLSKAIETAKDFGLLRAQ
FAHVDFTKEDYSNTHGAVTTTPPPFPLSSGELWYSWYGSIKPDERELARVKRIYKDYLKP
EV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctccttacaacgcattgggatagttgcttgccgcacatttcccgttaattta
caacgacatcttcaagcacagagaattcgtgatgtaagaataacgtccattgtcgctccg
gtgcatcgtgtcaattattgtgcatcatcttcatctgctgataacaccaattcagcggag
acgctatctagatatgcagacacaccatgggagtacttaaaaagtgaagaatacattgaa
cgctatggaacaaagcctgtgtggacaaactacaggaggaatcataaaggtgggatccca
cctcaaaagacaagaaaaacctgtattagaggagataagaaatgtgcgaacccgtgtccc
atctgtcgtgatccaaatatcattatccattacaagaatgtgaacttgttgcagcagttc
ttttgtcctgaaactggagtggtacatgatcccacagtaaccggtgtgtgcatgaagcaa
cagaaactacttagcaaggctattgaaactgctaaagattttggtttacttcgtgcccag
tttgcacatgtggatttcactaaagaagactattcaaacactcatggtgctgtaaccaca
actcctcctccatttcccctcagctctggagaactgtggtattcttggtatggtagtata
aaaccagacgagcgagaactggcaagagtgaagcggatctacaaagactaccttaaacct
gaagtctga

DBGET integrated database retrieval system