KEGG   Danio rerio (zebrafish): 553952Help
Entry
553952            CDS       T01004                                 

Gene name
ugt2a2
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide A2 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00040  Pentose and glucuronate interconversions
dre00053  Ascorbate and aldarate metabolism
dre00140  Steroid hormone biosynthesis
dre00830  Retinol metabolism
dre00860  Porphyrin and chlorophyll metabolism
dre00980  Metabolism of xenobiotics by cytochrome P450
dre00982  Drug metabolism - cytochrome P450
dre00983  Drug metabolism - other enzymes
dre01100  Metabolic pathways
Module
dre_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    553952 (ugt2a2)
   00053 Ascorbate and aldarate metabolism
    553952 (ugt2a2)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    553952 (ugt2a2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    553952 (ugt2a2)
   00860 Porphyrin and chlorophyll metabolism
    553952 (ugt2a2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    553952 (ugt2a2)
   00982 Drug metabolism - cytochrome P450
    553952 (ugt2a2)
   00983 Drug metabolism - other enzymes
    553952 (ugt2a2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     553952 (ugt2a2)
Glycosyltransferases [BR:dre01003]
 Others
  Hydrophobic molecule
   553952 (ugt2a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C Glyco_transf_4 NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 553952
NCBI-ProteinID: NP_001018306
ZFIN: ZDB-GENE-080721-21
Ensembl: ENSDARG00000051940
Vega: OTTDARG00000029251
UniProt: B8JMA7
Position
5
AA seq 534 aa AA seqDB search
MMKCLLKPSPLVLIFIFSFTHAGNVLVLPGEYSHWQNMRNVVDELLNRNHTVTVLVCSAS
PTINFTQQERFQYLVFEVPLSAQELDGASEELIHIWTQHPSPNRLQTALQIIELLGRVRV
MHRAMCDSMLRNDALIAQLSALKFDVLFNDPMFMCADLLAEMLGLPLVLSVRISPGFCLE
RMCGQMPAPPSFVPITQTVLTDRMCFMERVQNMIANIVFSVSFYIVAWISLDSYYTDVLG
KPTTMCETMGKADIWLIRTYWDFEYPRPFPPNFKFVGGLHCKPAKPLSKEMEEFVQSSGD
HGVVVFSLGSMIKNLTSERANTIAAALGQIPQKVVWRYSGKTPETLAPNTKIYDWIPQND
LLGHPKTKAFITHGGTNGLYEAIYHGVPMVGLPLFADQPDNLLHMKTKGAAVVLDINTLE
SKDLVDALKTVLNNPSYKESIMRLSRIHHDQPMKPLDQAVYWIEFVMRNKGAKHLRVQAH
ELSWYQYHCLDVAAFLLSIAALITFLWVKACCFLFRRCVRKTRPERKTQKSKNE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtgcttattaaagccgtctccgcttgtcctaatcttcatattcagctttacg
cacgccggtaacgtgctcgttttaccgggcgagtacagccactggcagaacatgagaaac
gtagtagacgagctgctgaatagaaaccacacagtaacagttctggtgtgctcggcctct
ccaaccatcaacttcacccagcaggagaggtttcagtatctggtgtttgaggtgcctttg
agtgcgcaggagttggacggagcgagcgaagagctgatccacatctggacgcagcatccc
agtccaaaccgactccagaccgctctccaaatcatagagctgctcgggagagtgcgcgtg
atgcaccgggcaatgtgcgactccatgctgcgtaatgacgcgttaatcgcgcagctgtcc
gctttaaaatttgacgtgctcttcaacgatcctatgttcatgtgtgccgatctgctggct
gagatgttgggtcttcctttggtgctttctgtgcgaatttcaccggggttttgtttggag
aggatgtgcggacagatgcccgctccgccgtcgtttgtaccgatcactcagacggttttg
acggatcgcatgtgcttcatggagagagtgcagaacatgatcgccaatattgttttttcc
gtctcgttttacatagtggcttggataagtttggatagttactacactgatgtattaggt
aaacccacaactatgtgtgagaccatgggaaaagcagatatctggctgataagaacgtac
tgggatttcgagtatccgcgtccattcccacctaactttaagtttgttggaggactgcac
tgcaaacctgccaaacccctgtctaaggaaatggaggagtttgttcagagctctggagat
cacggcgtcgttgttttctcattgggctccatgattaaaaacctgacatcggaaagagcc
aacactattgctgctgctctgggccagatcccgcaaaaggttgtttggcgttacagtggg
aaaactccagaaacactggctcccaatactaaaatctacgactggatcccacagaatgat
ttgcttggtcatccaaaaacgaaggctttcatcactcatggtggcacaaatggactgtat
gaggctatttatcacggtgtcccgatggtgggtttgccactgtttgctgatcagcctgat
aacctactgcacatgaaaaccaaaggagctgctgtagtccttgatatcaacacactggaa
tccaaagacctggtggatgctctaaagactgtcttaaataacccatcgtacaaggagagc
atcatgaggctgtccagaatccaccacgatcagccgatgaagccgctggatcaggccgtg
tactggattgagtttgtgatgcggaataaaggagccaaacatctgcgagttcaggcgcat
gagctgagctggtatcagtaccactgtctggatgtcgcggccttcttactctccatcgcc
gctctgatcacattcctctgggttaaagcatgctgcttccttttccgcagatgtgtcagg
aaaacccgtcctgagaggaaaacacagaagagtaaaaatgagtga

DBGET integrated database retrieval system