KEGG   Danio rerio (zebrafish): 554998Help
Entry
554998            CDS       T01004                                 

Gene name
pdia4, cai, wu:fd20c07, zgc:113965, zgc:136625, zgc:56014, zgc:77773
Definition
protein disulfide isomerase family A, member 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    554998 (pdia4)
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     554998 (pdia4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
24
AA seq 645 aa AA seqDB search
MKKITLLLIMLLGVTHFIKPHRCEDDAKDDSAEDLGEEEDDDDDDDDDDDEDADDTEVKE
ENGVLVLTDANFDTFIEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKENDPPIPVAKV
DATKASGLGSRFEVSGYPTIKILKKGEPLDYDGDRSEHAIVERVKEVAQPDWKPPPEATL
VLTKDNFDDVVNNADIILVEFYAPWCGHCKGLAPEYEKAAKELSNRTPPIPLAKVDATAE
SDLATRFGVSGYPTLKIFRKGKAFDYNGPREKFGIVDYMSDQAGPPSKQVQTLKQVQELL
RDGDDAVIVGVFSSDEDAAYEIYQEACNSLREDYKFMHTFNNDVTKFLKASPGQVVMLQP
EKFRSKHESASHSLTIKDSTPASEVQDFFKKHILPLVGHRRQSNDAKRYTKRPLVVVYYG
VDFSFDYRVATQFWRSKVLEVAKDFPEYTFAIADEEDYADELKSLGLSESGEEVNVGIVG
EGGKKYAMEPEEFDSDVLRSFVMAFKKGKLKPIVKSQPLPKNNKGPVKVVVGKTFDEIVM
DSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGF
PTIYFAPSNNKQNPIKFEGGKRDVEEFSKFVEKHATKLSHKKDEL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattacgcttctattgattatgttgcttggagtgacacacttcattaaacca
caccgatgcgaagacgatgccaaagatgattcagcagaagatctgggagaagaggaagat
gatgatgatgatgatgatgacgacgatgatgaggatgcagatgacactgaagtaaaggaa
gagaatggggtgctagtcctgacagatgcaaactttgacaccttcatcgagggcaaagac
accgtattggtggagttctatgcaccatggtgtggccactgcaaacagtttgctcccgag
tatgaaaagatcgctcagacgctgaaggaaaatgacccacctattccagtggcaaaggtt
gatgccactaaagccagtggtttgggcagcaggttcgaagtttctggatatcccaccatc
aaaatacttaaaaagggagagcccctggactatgatggggatcggagtgagcatgccatc
gtggaacgggttaaagaagttgcccaaccagactggaaacctcctccagaggctactcta
gtcttgactaaagacaattttgatgatgtggtgaacaatgctgacatcattctggtggag
ttttatgcaccctggtgtggccactgtaagggacttgcacctgaatatgagaaggctgct
aaagagctcagcaaccgcactcctcctattccactggctaaagtggatgccactgcagaa
agcgatttagcgacacggtttggtgtttctggctacccaactctcaaaatcttcagaaag
ggaaaggcttttgactacaatggaccccgggagaagtttggtattgttgattacatgtca
gaccaggctggtcctccatcaaagcaggtccagaccctgaaacaggttcaggagctgctc
agggatggagatgatgctgttattgttggcgttttctccagcgatgaagatgcagcgtat
gagatctatcaagaagcatgtaactctctgagagaggattacaaattcatgcacaccttt
aataacgatgtcacaaaattcctcaaggcttcacctggacaagtagtcatgctccagcca
gagaagttcagatcaaaacatgagagtgcatctcattcactaacgattaaagattccaca
cctgcttcagaagttcaagatttcttcaagaaacacatacttcctttggttgggcacaga
aggcagagcaacgacgcaaaaagatacaccaagcgaccacttgtggttgtttattacgga
gtagacttcagttttgactacagagtggccacacagttttggaggagcaaagtgcttgaa
gtagcaaaagacttcccggagtacacgtttgccattgcggatgaggaagattatgctgat
gaactgaagagccttggactgagtgaaagtggcgaggaggtgaacgttggcattgttggt
gagggaggaaagaaatatgctatggagccagaggagtttgactccgatgttctccgtagc
tttgtcatggcgttcaaaaaaggtaaactgaaacctattgtaaagtctcagccccttccc
aaaaacaacaaaggaccggtgaaggttgtggtgggaaagacttttgatgaaattgttatg
gactcgaagaaagatgtcctcattgagttctatgccccgtggtgcggtcactgtaagaag
ctggagccagattacatatctcttggaaagaaatacaaaaacgagaagaatctcgtcatt
gccaaaatggacgccactgctaatgatgtgcctcatgacagttataaagtggagggtttc
cctacaatctactttgctccaagcaacaacaagcagaaccccatcaaatttgaaggtggc
aaaagggatgtggaggagttcagcaaatttgtggaaaaacacgcaacgaaattatcacac
aaaaaagatgagctctag

DBGET integrated database retrieval system