KEGG   Danio rerio (zebrafish): 563181Help
Entry
563181            CDS       T01004                                 

Gene name
map2k2a, map2k2, wu:fa56c06, zgc:123171
Definition
mitogen-activated protein kinase kinase 2a (EC:2.7.12.2)
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    563181 (map2k2a)
   04012 ErbB signaling pathway
    563181 (map2k2a)
   04370 VEGF signaling pathway
    563181 (map2k2a)
   04068 FoxO signaling pathway
    563181 (map2k2a)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    563181 (map2k2a)
  Cell communication
   04540 Gap junction
    563181 (map2k2a)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    563181 (map2k2a)
  Endocrine system
   04910 Insulin signaling pathway
    563181 (map2k2a)
   04912 GnRH signaling pathway
    563181 (map2k2a)
   04916 Melanogenesis
    563181 (map2k2a)
  Circulatory system
   04270 Vascular smooth muscle contraction
    563181 (map2k2a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     563181 (map2k2a)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   563181 (map2k2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 397 aa AA seqDB search
MAPKRRPVPLIITPTGEGQSTNIDAAAEANLEALQRKLGELDLDEQQRKRLEAFLTQKAQ
VGELKDEDFEPICELGAGNGGVVHKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQVLH
ECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGLAY
LREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH
YSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVLDAGGAEGHSMSPRPRPPGR
PVSGHGMDSRPAMAIFELLDYIVNEPPPKLPHGVFTTDFEEFVTKCLIKNPADRADLKML
MGHTFIKRAEVEEVDFAGWLCKTMGLHQPSTPTHSAE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaaagaagaccagtccccttgattataacccccactggagagggacagtca
accaacattgatgcagcagcagaggccaacctggaggccttgcagaggaagttaggtgag
ctggatttggatgaacagcagaggaagcgcctcgaagctttcctcacccagaaagcccag
gtgggcgagctcaaggatgaagatttcgaacccatatgtgaacttggcgctggtaatggt
ggagtggttcataaagtccgtcacaaaccctcgagactggttatggccaggaagcttata
cacttggaaatcaaaccagccatcaggaaccagattattcgagagctgcaggttctacac
gagtgtaactcaccgtacattgtagggttttacggcgccttctacagtgatggagaaatc
agcatctgtatggagcacatggatggaggctctttggatcaagtgctcaaagaagccaga
agaatccctgaggaaattttgggcaaagttagcatagctgtactcagaggtttggcgtat
cttcgggagaagcaccaaataatgcacagagacgttaagccctccaacatcctggtgaac
tcgcgcggtgagatcaaactgtgcgactttggtgtgagtggccagctcatcgactctatg
gccaactccttcgttggaacacggtcgtacatgtcgccggagagactccagggcacgcac
tactcggttcagtcggatgtgtggagcatgggcctatcactggttgagcttgctattgga
cgctaccccatcccccctcccgatgctaaggaactggaggccatatttggccggccagtg
ctggatgcaggtggggcagaaggtcacagcatgtctccaagacccaggcctccaggacga
ccagttagtggacacggaatggacagcaggccagcaatggctatatttgagctactggac
tacattgtcaatgagcctccacccaagctcccccatggcgtcttcaccacagactttgag
gagtttgtgacaaaatgcctcataaagaaccctgctgacagagctgacctcaagatgcta
atgggtcacacgttcatcaagcgggctgaggttgaggaggtggattttgctggatggttg
tgtaaaaccatgggccttcaccagcctagcacacccactcatagcgctgaatga

DBGET integrated database retrieval system