KEGG   Danio rerio (zebrafish): 563181Help
Entry
563181            CDS       T01004                                 

Gene name
map2k2a
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04270  Vascular smooth muscle contraction
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04620  Toll-like receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Module
dre_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    563181 (map2k2a)
   04012 ErbB signaling pathway
    563181 (map2k2a)
   04370 VEGF signaling pathway
    563181 (map2k2a)
   04371 Apelin signaling pathway
    563181 (map2k2a)
   04068 FoxO signaling pathway
    563181 (map2k2a)
   04150 mTOR signaling pathway
    563181 (map2k2a)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    563181 (map2k2a)
  Cell growth and death
   04210 Apoptosis
    563181 (map2k2a)
   04218 Cellular senescence
    563181 (map2k2a)
  Cellular community - eukaryotes
   04540 Gap junction
    563181 (map2k2a)
  Cell motility
   04810 Regulation of actin cytoskeleton
    563181 (map2k2a)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    563181 (map2k2a)
  Endocrine system
   04910 Insulin signaling pathway
    563181 (map2k2a)
   04912 GnRH signaling pathway
    563181 (map2k2a)
   04916 Melanogenesis
    563181 (map2k2a)
  Circulatory system
   04270 Vascular smooth muscle contraction
    563181 (map2k2a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     563181 (map2k2a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE7 family
   563181 (map2k2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 563181
NCBI-ProteinID: NP_001032468
ZFIN: ZDB-GENE-041027-1
Ensembl: ENSDARG00000006609
Vega: OTTDARG00000010261
UniProt: Q1LY62
Position
22
AA seq 397 aa AA seqDB search
MAPKRRPVPLIITPTGEGQSTNIDAAAEANLEALQRKLGELDLDEQQRKRLEAFLTQKAQ
VGELKDEDFEPICELGAGNGGVVHKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQVLH
ECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGLAY
LREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH
YSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVLDAGGAEGHSMSPRPRPPGR
PVSGHGMDSRPAMAIFELLDYIVNEPPPKLPHGVFTTDFEEFVTKCLIKNPADRADLKML
MGHTFIKRAEVEEVDFAGWLCKTMGLHQPSTPTHSAE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaaagaagaccagtccccttgattataacccccactggagagggacagtca
accaacattgatgcagcagcagaggccaacctggaggccttgcagaggaagttaggtgag
ctggatttggatgaacagcagaggaagcgcctcgaagctttcctcacccagaaagcccag
gtgggcgagctcaaggatgaagatttcgaacccatatgtgaacttggcgctggtaatggt
ggagtggttcataaagtccgtcacaaaccctcgagactggttatggccaggaagcttata
cacttggaaatcaaaccagccatcaggaaccagattattcgagagctgcaggttctacac
gagtgtaactcaccgtacattgtagggttttacggcgccttctacagtgatggagaaatc
agcatctgtatggagcacatggatggaggctctttggatcaagtgctcaaagaagccaga
agaatccctgaggaaattttgggcaaagttagcatagctgtactcagaggtttggcgtat
cttcgggagaagcaccaaataatgcacagagacgttaagccctccaacatcctggtgaac
tcgcgcggtgagatcaaactgtgcgactttggtgtgagtggccagctcatcgactctatg
gccaactccttcgttggaacacggtcgtacatgtcgccggagagactccagggcacgcac
tactcggttcagtcggatgtgtggagcatgggcctatcactggttgagcttgctattgga
cgctaccccatcccccctcccgatgctaaggaactggaggccatatttggccggccagtg
ctggatgcaggtggggcagaaggtcacagcatgtctccaagacccaggcctccaggacga
ccagttagtggacacggaatggacagcaggccagcaatggctatatttgagctactggac
tacattgtcaatgagcctccacccaagctcccccatggcgtcttcaccacagactttgag
gagtttgtgacaaaatgcctcataaagaaccctgctgacagagctgacctcaagatgcta
atgggtcacacgttcatcaagcgggctgaggttgaggaggtggattttgctggatggttg
tgtaaaaccatgggccttcaccagcctagcacacccactcatagcgctgaatga

DBGET integrated database retrieval system