KEGG   Danio rerio (zebrafish): 65237Help
Entry
65237             CDS       T01004                                 

Gene name
mapk14a, MAPK14, fk28c03, hm:zeh1243, p38, p38a, wu:fk28c03, zp38a
Definition
mitogen-activated protein kinase 14a (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    65237 (mapk14a)
   04370 VEGF signaling pathway
    65237 (mapk14a)
   04068 FoxO signaling pathway
    65237 (mapk14a)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    65237 (mapk14a)
   04621 NOD-like receptor signaling pathway
    65237 (mapk14a)
   04622 RIG-I-like receptor signaling pathway
    65237 (mapk14a)
  Endocrine system
   04912 GnRH signaling pathway
    65237 (mapk14a)
   04914 Progesterone-mediated oocyte maturation
    65237 (mapk14a)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    65237 (mapk14a)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    65237 (mapk14a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     65237 (mapk14a)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   65237 (mapk14a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 361 aa AA seqDB search
MSQKERPTFYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPF
QSIIHAKRTYRELRLLKHMRHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPSSLISRMPSHEARTYISSLPQMPKRNFADVFIGANPQAVDLLEKMLVLDTDKRITA
AEALAHPYFAQYHDPDDEPEAEPFDQSFESRELDIEEWKRQTYEEMISFEPPVFDVDEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaaagaaagacccactttctatcgacaggaggtcaacaagacgatttgggag
gtccccgtgcagtatcagaacttgtctcccgtgggctccggtgcatacggatctgtttgc
tctgcgtttgatgcaaagacaggatttaaagttgctgtgaagaagctctcgaggccattt
cagtccatcatccatgccaagcggacctacagggagctgaggctactcaagcacatgaga
catgagaatgtgatcggcttgctggatgtttttacacctgccacaagtctgaaggagttt
aatgatgtgtacctggtgactcaccttatgggcgctgacctgaataacatcgtaaagtgt
cagaaactgaccgacgatcacgtccagttcctcatttaccagatactgagaggactaaag
tacatccattcagctgacataattcacagggatttgaaacccagtaatctggcagtaaat
gaagactgtgaactcaagattcttgactttggcttggctcgacacacagatgatgagatg
actgggtatgtggccacaaggtggtatcgtgcccctgagatcatgctcaactggatgcac
tacaacgtgacggtggacatttggtcagtgggctgcatcatggctgagctgctgacgggc
aggactctgttccctggcaccgatcatataaaccagcttcagcagataatgcgacttaca
ggaactcctccttcctctctaataagcaggatgcctagccatgaggctcgtacttacatc
agctcacttcctcagatgcccaagaggaattttgcagatgtgtttatcggggcaaatcca
caagctgtggacctcttggagaaaatgctggttttggacactgataagcggattacagca
gcagaggctctggcacatccatactttgcccaatatcatgacccggatgatgaacccgaa
gcagagccttttgaccagagctttgagagccgagagctggatattgaggagtggaaacgt
cagacatacgaggagatgatcagttttgagcctccagtctttgatgtggatgaaatggag
tcttga

DBGET integrated database retrieval system