KEGG   Dinoroseobacter shibae: Dshi_1031Help
Entry
Dshi_1031         CDS       T00612                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dshi_1031 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dshi_1031 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dshi_1031 (trpB)
Enzymes [BR:dsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dshi_1031 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1064459..1065691
Genome map
AA seq 410 aa AA seqDB search
MPDDLINSFMTGPDENGRFGDFGGRFVSETLMPLILELERQYEFAKTDQAFWDEMHHLWT
HYVGRPSPLYFAERLTERLGGAKVYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVERQAPNVFRMKLLGAEVVPVTSGRGTLKDA
MNDALRDWVTNVRETFYCIGTVAGPHPYPAMVRDFQAIIGQEAREQMMEAEGRLPDTLIA
AIGGGSNAMGLFYPFLDDKEVAIIGVEAGGKGVNEKMEHCASLTGGRPGVLHGNRTYLLQ
DDDGQILEGFSISAGLDYPGIGPEHAWLHDIGRAKYVSITDAEALDAFQLCCETEGIIPA
LEPSHALAHVAKIAPDLPRDHIICMNMCGRGDKDIFTVAKALGQDMSGAV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgacctgatcaattccttcatgaccggcccggacgagaatggccggttcggc
gatttcgggggccggttcgtctccgagaccctgatgccgctcatcctggagctcgaacgc
caatacgagttcgccaagaccgaccaggccttctgggacgagatgcaccatctctggacc
cattacgtgggccggcccagcccgctctatttcgccgaacgcctgaccgagcggctgggc
ggcgcgaaggtctacctcaagcgggacgagctgaaccacaccggcgcgcacaagatcaac
aacgtgttgggccagatcatcctcgcccgccgcatgggcaagacccgcatcatcgccgag
accggcgcgggccagcacggcgttgccacggccacggtctgcgccaagttcggcctgaaa
tgcgtggtctacatgggcgcccatgatgtcgaacgccaggcgcccaacgtcttccgcatg
aagctgctgggcgccgaggtcgtgcccgtcacctccggtcgcggcacgctcaaggacgcc
atgaacgacgcgttgcgcgactgggtcaccaatgtgcgcgagaccttctactgcatcggc
acggtcgcgggcccgcacccgtacccggccatggtccgcgatttccaggcgatcatcggc
caggaggcccgcgagcagatgatggaggccgagggccggctgcccgatacgctgatcgcc
gcgatcggcgggggctccaacgccatgggcctgttctacccgttcctcgatgacaaggag
gtcgcgatcatcggggtggaggccggcggcaagggcgtcaacgagaagatggagcattgc
gcatccctgaccggtggccgcccgggcgtgctccatggcaaccgcacctacctgctgcag
gacgatgacggccagatcctcgaaggcttctcgatctccgccgggctggactatcccggc
atcggaccggagcatgcctggctgcacgatatcggacgggcgaaatatgtctcgatcacc
gatgccgaggcgctcgacgccttccagctctgctgcgagaccgagggcatcatccccgcg
ctggagccgtcgcacgcgctggcccatgtggccaagatcgcgccggacctgccccgcgac
cacatcatctgcatgaacatgtgcggacgcggcgacaaggacatcttcaccgtcgccaag
gcgctgggtcaggacatgtccggcgcggtctga

DBGET integrated database retrieval system