KEGG   Drosophila simulans: Dsim_GD10831Help
Entry
Dsim_GD10831      CDS       T01065                                 

Definition
GD10831 gene product from transcript GD10831-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dsi  Drosophila simulans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dsi00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 596 aa AA seqDB search
MSNGRYGRFGALIGVACVSSTHCRFLIYSTKNAEVLAYHELKLRQIVHQAGWMEYDPSEI
WKNTQECIETAYKNLVILEINPRDIIAIGIVNQRGTSVLWNLETGQPLHNAIGWSDCRST
PILKTLLHNVRHNVDYVRYRSGLPLSSCFSALKIRWLMDHVPAVATAIEENKCLFGTLDS
WLLWNLTGGVEMGVHSTDLTNAHYTSLMNVSTEQWDPKLCQFFRVPLNILPRIRSNSEIF
GYVLEGPLHGTPIAAMMGEQPASLLGQLCVKAGQNVCTLDDSCFVLLNTGREKLDSANGL
ITGIAHKLGEKEATNYTLEGAISNAGSTVTWLRDKLQINTEINSNDNVVESLNTFIGENS
MISSSCSSSMLNAECGLAAKRSEITFVPAFHGLYAPYWRHDARGIILGLTSQTTSENIAQ
AAYEATGFQIFEVLQAFKRDTPNWDRSCMQPVLTFGGDYAENSHLVQFIADIIGYMLERP
QTTSPAGLGVMITAGVTMKVVSLEHAVKMYTPPTDVFSPTTTKNRRELLYKRWDYAVKKC
LHWNNYETYEADIELFAQRELDPNLPVRRSVPGSIFLTTSFAMILLANYLKINPLK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgggcgctacgggagattcggagctctcatcggcgtcgcctgcgtgagcagc
acccactgccgctttctgatatactcaacgaaaaatgccgaggtcctggcctaccatgag
ctcaagctgcgacagattgtccaccaggcgggctggatggagtacgatccgtcagagata
tggaagaacacacaggagtgcatagagaccgcctataagaacctggttatactggagatc
aatccacgtgatattattgccattggtatcgtaaatcagcggggaacctcggtgttatgg
aatttggagacgggacaaccgctgcacaatgccatcggctggtcagattgccgcagcact
cccatcctgaagaccctgctccataatgtccggcacaatgtggactacgtgaggtatcgc
agtggcttgcccctgagcagctgtttcagtgccctaaagatccgttggctgatggatcac
gttcctgccgtagccactgccattgaggagaacaagtgcttattcggcaccttagactcc
tggcttctgtggaatctcaccggcggcgttgagatgggggtgcattctactgaccttacc
aatgctcactacacctcccttatgaacgtgtccacagagcaatgggatcctaaactatgc
cagttctttcgagtgcccctgaacatactgccacggatacgatccaactccgaaatcttc
ggctatgtgctggagggtcctttgcatggcacccccatagcggccatgatgggtgagcag
cccgcaagtttgttgggccaactctgcgtgaaggccgggcaaaatgtgtgcaccctggac
gatagctgtttcgtgctcctcaacacgggcagggagaagctagactctgcaaacggactg
ataacgggcatagctcacaagctgggcgaaaaagaggccactaactacacacttgaggga
gccatttcaaatgccggttccacggttacatggctgcgggataagctacagatcaatact
gagattaattccaatgataacgtggtggagtctttaaatacattcatcggcgagaactcg
atgatctcgtcctcttgttcctcatccatgctgaatgccgagtgtggtctggcggccaag
aggtcggaaattacgtttgtgccggcatttcatggcttgtacgctccctactggcggcac
gatgccaggggcataatcttgggacttaccagccagaccacatcggaaaacattgcccaa
gcagcttacgaggccaccgggttccagatctttgaagtgctacaggcgttcaagcgcgat
acacccaactgggaccgatcctgcatgcagcccgtgcttacattcggcggtgattacgcc
gaaaactcgcatttggtgcagttcatagcagatattattggctacatgctggagcgacca
cagaccacctcacctgctggcttgggcgttatgataaccgcaggcgtgacgatgaaagtg
gtgtccctggagcatgccgtaaaaatgtacactccgcccactgatgtcttttcgccaaca
actaccaaaaatcgacgagagctgctctacaagcgctgggactatgcggtaaagaaatgc
ctgcactggaacaactacgagacgtacgaggctgatattgaactgtttgctcagcgagaa
cttgatcccaacttacctgttaggcgttccgtaccgggcagtatattcctgaccacgtcg
tttgcgatgattctcctggctaactacttaaagatcaatcccctgaaatag

DBGET integrated database retrieval system