KEGG   Dechlorosoma suillum: Dsui_0407Help
Entry
Dsui_0407         CDS       T01657                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dsu  Dechlorosoma suillum
Brite
Enzymes [BR:dsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dsui_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(405518..406183)
Genome map
AA seq 221 aa AA seqDB search
MEQVQNMEQARFNMIEQQIRPWNVLDQDVLDLLSEVRREEFVPAAHQALAFADLEIPLGE
GAVMLAPKMEAKLLQELAVQPKDKVLEIGTGSGYMAALLAAKADQVTSVEISPAIAKTAK
ANLAKAGISNVSVEVGDGVHGWAAGAPYDVIVVSGSLPVVPEELLQQLKVGGRMAVFVGE
APVMEAQIVTRTGETTFASLNLFETVVAPLQNAPAKERFRF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagtgcaaaacatggaacaagcccgcttcaacatgatcgagcagcagatccgg
ccttggaacgtgctggaccaggatgtgctggacctgctgtccgaggtccggcgcgaggag
ttcgtccccgccgcccatcaggccctggcctttgccgacctggagatccccctgggcgaa
ggcgccgtgatgctggcccccaagatggaagccaagctgctgcaggaacttgccgtgcaa
cccaaggacaaggtcctggaaatcggtaccggctccggctacatggccgccctgctcgcc
gccaaggctgaccaggtgaccagcgtcgaaatcagcccggccatcgccaagaccgccaag
gccaacctggccaaggccggcatcagcaacgtctccgtcgaagtgggtgatggcgtgcat
ggctgggccgccggcgctccctacgacgtaatcgtcgtttccggttccctgccggtggtg
cccgaagaactgctgcaacagctcaaggttggtggtcgcatggccgtatttgtcggtgag
gccccggtgatggaagcccagatcgtcacccgcaccggcgagaccaccttcgccagcctc
aatcttttcgaaaccgtggtggcgcccctgcagaacgcgccggccaaggagcgtttccgt
ttctga

DBGET integrated database retrieval system