KEGG   Desulfurobacterium thermolithotrophum: Dester_0172Help
Entry
Dester_0172       CDS       T01427                                 

Definition
(RefSeq) succinyl-CoA ligase (ADP-forming) subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dester_0172
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dester_0172
   00640 Propanoate metabolism
    Dester_0172
   00660 C5-Branched dibasic acid metabolism
    Dester_0172
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dester_0172
Enzymes [BR:dte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dester_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(163914..165083)
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQAKEIFKKYKLPVPNGIVVYNAQEAEEAAKELGTPVVVVKAQVHAGGRGKAGGV
KLAKSPEEAGKIASEMIGNRLRTYQNPEGLPINCVLVEAGVNIDKEFYVGLTLDREVSRP
VLMVSAAGGMEIEEIAKTNPELIIKEHIDPAIGLLPYQARKIAYKVGITDKNLLSQFVKI
AMTLSKMYFELDASLIEINPLVQTKEGEFICLDAKIDFDDNALFRHKDIQELEDTTQIDP
LELEAKKWDLNYVKLDGNIGCMVNGAGLAMATMDTIKYYGGEPANFLDVGGTATVERVAA
AFKLLLSDPNVKAIFVNIFGGIVRCDRIAGGIIEAAKQVELDRPLIVRLEGTNVELGRKM
LEESGLNIIPAKDMADGAQKAVKAAKGKL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacacgaatatcaggcaaaagaaattttcaaaaagtataaactacctgttcct
aatggaatagttgtttacaacgctcaagaagctgaagaagctgctaaagaattaggaaca
cctgtagttgttgtaaaagctcaggtccacgctggaggaagaggaaaggctggaggagtc
aaacttgcaaagtctccagaggaagctggaaaaattgcttccgaaatgataggcaaccgc
cttagaacttatcaaaatccagaaggtcttccaataaattgtgtattagttgaagccgga
gtaaatatagacaaagaattttacgtaggtcttactcttgatagagaagtttcaagacct
gttttaatggtttctgctgctggtggaatggaaattgaagaaatagcaaaaacaaatcca
gagctcattattaaagaacacattgatcctgcaattggtcttcttccatatcaggcaagg
aaaatcgcttataaggttggaattacagacaagaatcttctttcccagtttgtaaagata
gcaatgactttaagcaaaatgtactttgaacttgacgcatcattaattgaaattaacccg
cttgttcagacaaaagagggagagtttatatgtcttgatgcaaaaattgactttgacgac
aatgcactctttaggcataaagacatacaagagcttgaagatacaactcaaatcgatcct
cttgagcttgaagctaaaaagtgggatctcaactacgttaagcttgatggaaacatcggt
tgtatggttaacggtgcaggtcttgcaatggctactatggatacaatcaagtactacggc
ggagaacctgcaaacttcttagacgttggtggtactgcaacagttgaaagagtagcagca
gcatttaagctccttctttccgatccaaacgttaaggcaatttttgtaaacatcttcggt
ggaatcgtaaggtgcgataggattgcaggaggaattattgaagctgcaaagcaggttgaa
ctcgatagacctctcatcgtaagacttgaaggaacaaacgttgaacttggtagaaaaatg
cttgaagaaagtggtttaaacatcattccagcaaaagacatggctgacggtgcacaaaaa
gctgtaaaagctgccaaaggtaaactataa

DBGET integrated database retrieval system