KEGG   Desulfurobacterium thermolithotrophum: Dester_0172Help
Entry
Dester_0172       CDS       T01427                                 

Definition
succinyl-CoA ligase (ADP-forming) subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dester_0172
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dester_0172
   00640 Propanoate metabolism
    Dester_0172
   00660 C5-Branched dibasic acid metabolism
    Dester_0172
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dester_0172
Enzymes [BR:dte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dester_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(163914..165083)
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQAKEIFKKYKLPVPNGIVVYNAQEAEEAAKELGTPVVVVKAQVHAGGRGKAGGV
KLAKSPEEAGKIASEMIGNRLRTYQNPEGLPINCVLVEAGVNIDKEFYVGLTLDREVSRP
VLMVSAAGGMEIEEIAKTNPELIIKEHIDPAIGLLPYQARKIAYKVGITDKNLLSQFVKI
AMTLSKMYFELDASLIEINPLVQTKEGEFICLDAKIDFDDNALFRHKDIQELEDTTQIDP
LELEAKKWDLNYVKLDGNIGCMVNGAGLAMATMDTIKYYGGEPANFLDVGGTATVERVAA
AFKLLLSDPNVKAIFVNIFGGIVRCDRIAGGIIEAAKQVELDRPLIVRLEGTNVELGRKM
LEESGLNIIPAKDMADGAQKAVKAAKGKL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacacgaatatcaggcaaaagaaattttcaaaaagtataaactacctgttcct
aatggaatagttgtttacaacgctcaagaagctgaagaagctgctaaagaattaggaaca
cctgtagttgttgtaaaagctcaggtccacgctggaggaagaggaaaggctggaggagtc
aaacttgcaaagtctccagaggaagctggaaaaattgcttccgaaatgataggcaaccgc
cttagaacttatcaaaatccagaaggtcttccaataaattgtgtattagttgaagccgga
gtaaatatagacaaagaattttacgtaggtcttactcttgatagagaagtttcaagacct
gttttaatggtttctgctgctggtggaatggaaattgaagaaatagcaaaaacaaatcca
gagctcattattaaagaacacattgatcctgcaattggtcttcttccatatcaggcaagg
aaaatcgcttataaggttggaattacagacaagaatcttctttcccagtttgtaaagata
gcaatgactttaagcaaaatgtactttgaacttgacgcatcattaattgaaattaacccg
cttgttcagacaaaagagggagagtttatatgtcttgatgcaaaaattgactttgacgac
aatgcactctttaggcataaagacatacaagagcttgaagatacaactcaaatcgatcct
cttgagcttgaagctaaaaagtgggatctcaactacgttaagcttgatggaaacatcggt
tgtatggttaacggtgcaggtcttgcaatggctactatggatacaatcaagtactacggc
ggagaacctgcaaacttcttagacgttggtggtactgcaacagttgaaagagtagcagca
gcatttaagctccttctttccgatccaaacgttaaggcaatttttgtaaacatcttcggt
ggaatcgtaaggtgcgataggattgcaggaggaattattgaagctgcaaagcaggttgaa
ctcgatagacctctcatcgtaagacttgaaggaacaaacgttgaacttggtagaaaaatg
cttgaagaaagtggtttaaacatcattccagcaaaagacatggctgacggtgcacaaaaa
gctgtaaaagctgccaaaggtaaactataa

DBGET integrated database retrieval system