KEGG   Drosophila yakuba: Dyak_GE11423Help
Entry
Dyak_GE11423      CDS       T01068                                 

Gene name
Dyak_ST6Gal, ST6Gal, dyak_GLEANR_11756
Definition
(RefSeq) GE11423 gene product from transcript GE11423-RA (EC:2.4.99.-)
  KO
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dya  Drosophila yakuba
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dyak_GE11423 (Dyak_ST6Gal)
   00514 Other types of O-glycan biosynthesis
    Dyak_GE11423 (Dyak_ST6Gal)
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     Dyak_GE11423 (Dyak_ST6Gal)
Glycosyltransferases [BR:dya01003]
 Terminal extension
  Sialyltransferase
   Dyak_GE11423 (Dyak_ST6Gal)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 458 aa AA seqDB search
MRQVREMRKVTRASPGQSQALLSCLIIAVCAALIIQTGQIQGAKAQQGREPGVVNSGEPN
GNGNESSGHRVPRSVFHVRWNPNEKFIVESRENPAINSSKLAPHPRLKVSKNTKLTLSPK
LYLCHDKHSELCHNKTQQFRHRIVRAFEKAMVESVNESQANHYNVDYKPVFGDSFEEQYY
PSTCLVMEAGVRVLRRKDAPFNKLPFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLG
RFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFDFTRAPIFRNVTIAAWD
PGKYNGTLEDWLTSADYDLFTNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRPIS
RNPPSSGFIGLALLLPHCPQVDFVEYVPSTRLNGRCHYYSKEMNSACTFGSWHPLAAEKL
MALDMNMAEDDDMSVFQFGILRIRRPDKLLCGFNFFGY
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagacaagtgagggaaatgaggaaagtgacacgcgcatcgccgggtcaaagtcaggcc
ctcctttcctgcctcattatcgccgtgtgcgccgcattaataattcaaactgggcaaatc
cagggtgcaaaagctcagcagggacgcgaacctggtgtggtgaattcgggggaaccgaac
ggcaacggaaatgaaagcagtggccaccgcgtgccgcgcagtgtgttccacgtgcgctgg
aacccgaacgagaagttcatcgtggagagtcgcgagaacccggccatcaactcctccaag
ctggctccccatccccggctgaaggtctccaagaacaccaagctcacgctgagccccaag
ctctatctctgccacgacaagcactcggagctgtgccacaacaagacccagcagttccgc
caccgcattgtgcgggccttcgagaaggccatggtggagtcggtcaacgagtcgcaggcg
aaccactacaacgtggactacaaacccgtgttcggggacagcttcgaggagcagtactac
ccctccacctgcctggtcatggaagcgggcgtgcgggtcctgcgccgcaaggacgcgccc
ttcaacaagctgcccttcggccgcctctttccgcgccagaagctcttccgcaacgtgaag
gacatcaagacctgtgccatcgtctccagtgcgggatcgttggctggctccaagctgggc
cgctttatcgacacgcacgacattgtgatgagattcaatcatgcgcccacgcaaggacac
gaagtggatgttggcagcaaaaccacgattcgtgtggtgaattcgcaagtggtcaccaag
ccggaattcgacttcacccgggcccccatcttccggaacgtcacgatcgccgcctgggat
cccggcaagtacaacggcacgctggaggattggctcaccagcgccgactacgacctcttc
accaactacgagctgtacaggcggcgctatcccaagtcgcgggccttcctcatcgatccg
cactccgtgtggcgcctgtggcagagtctgcagatgtttgccggaaaccgcccgataagc
cggaatccccccagttccggtttcataggactggccctgctcctgccgcactgtccccag
gtggacttcgtggagtacgtgccgtccacgagactcaatggacgctgtcactactacagc
aaagagatgaattccgcctgcacattcggctcctggcatccgctggccgccgagaagctg
atggccctggacatgaacatggcggaggacgacgacatgtcggtcttccagttcggcatc
ctgcggattcgcaggccggacaaactgctctgcggcttcaacttctttggctactga

DBGET integrated database retrieval system