KEGG   Drosophila yakuba: Dyak_GE11838Help
Entry
Dyak_GE11838      CDS       T01068                                 

Definition
GE11838 gene product from transcript GE11838-RA
Orthology
K04437  
filamin
Organism
dya  Drosophila yakuba
Brite
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dyak_GE11838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 1624 aa AA seqDB search
MDVKDIKGAKVTHAGLLKHNSDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQFMLIAIVFQVHDWATDFCDGTCLCALVENLQTRPLKPSWNR
RPANQHHYLENATTALKSIEADHIKLVNIGNVDIVNGNIKLILGLIWSLIVRYQIGRSKF
PPRKLMLAWLQAALPDCRITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCT
QTMDLAQREFGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDP
VKNFTTDWNDGRVMCEIIKGLGGSAPAPDKLSTDPFHYENNIRKAVDAGARLGVQPILTA
KDMANPEVEHLGIMAYAAHLQWVPPRPPLSDLVSVYLESTSGRVGEPTHFRIDVMSRDIS
LSSVRCHVVPPSGQPGQPVRLNAHGEGVFVPERYGMHEIVVEIGEDSLGGHFFRALPRLL
QVAPPGMAPCALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKP
DEAGIWEIAITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVSGE
LHVDIVHDKHSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKG
RSGKTRSSPLHDSKHRSESPSMHFVSTTNTRHNDYRNSSLSRHNTAERTNSYSPQYSPKL
DTTDYHSASSRYYKRESEENHATPPPAPPPVSGSPTVKYLNSADLYTETLNGRRDSKTSN
SSSTKNDYYYDKENELYSQRRGVTKPKLTPPREERELTSTSNTMSSSSSSFQQRHQQLAT
STLTRSLSPIPSPTLNTRSSEVHTHSPLTIKTSNQYESSTRNINSSPRHASVSPVQRYSP
NSAYITTATHRMGSPLTSPVSKNGYESSRTVEKSSTYKSTSNYVTDSNIRASPSLYGTAE
RLRRTGSPEPRIDHSSNVRVSSMKPATARRDSWDVINKTKHMLSHNSLESLANMTEKQLN
TELQYNRPDLDHETHRNTQYNKFALHKQQQHQSDYRRDSPDDGERYKPSAITVKSHSNNT
YTDKSGGYTKTVKESSEHVVTESNGHGSAPGYGYSSLSRFRPIDSNATGARAIRVQDIPN
GSIGRPVEFEIDGSRAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGTHTVQITF
NGETVPGSPWHAEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTP
SKSKLNARVTHEAANGAARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTE
VNGGVVGQPCQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLID
IKFNGETVRGCPFVCAVADTSRVLLNLTNLELIPVNRPSSFHITVSGGGAAELAVSVRGP
QGELPVRVTGDIHAGFTAEFTPTTVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVS
RGTMGRPVQFTVDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTIN
VSFNKMPVPGCPITVGISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGRR
KLLY
NT seq 4875 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaggacataaaaggcgccaaggtgacgcatgcggggctgctcaagcacaac
tccgatggcaccaccgaaacgcagaagatcacccacgcgggtctggtggcccggagtccc
gagggcaccgccgccaagggcatgaacatacggggcaacgaggatctctgggtggagatc
caggcgaatacattccgcaactgggtcaacgagcatttgcgcgagacgggaatgcagttt
atgctaattgccattgtttttcaggtgcatgactgggccaccgatttctgcgatggcacc
tgcctgtgcgcccttgtggagaacctgcagacgcgtccactgaaaccctcgtggaatcgc
cggcccgcgaatcagcatcactatttggagaacgccactacagcgctgaagtccattgag
gcggaccacatcaagctggtgaacatcggcaacgtggacatcgtcaatgggaacataaag
ctgatcctgggtctgatctggtcgctcatcgtgcgctatcagatcggcagaagcaagttc
ccgccacgcaaactgatgttggcctggctgcaggccgcattgccggactgcaggatcacc
aatctgaccaccgattggaatagtggcgtcaatctggcggcgctgctagactactgccag
ccgggcctgttcccgcactggcggagtctcgatcccagccagagtgtgcgcaactgcacc
caaaccatggacttggcccagcgcgagtttggagtgcccaaggtcctggagccggagtac
ctggcctcaccctggttggatgagttatccggcatgacgtacctctcgtacttcatgaag
cccggtggtcctggctacaatgccaccatgcgatgggtgaatacgcaggtcaaggaccct
gtgaagaactttaccaccgactggaacgatggacgcgtcatgtgcgaaattattaaggga
ctgggtggctcggcgccagcaccggataagctcagcaccgatcccttccactacgagaac
aacatacggaaggcggtggacgcgggcgcccgtctgggcgtgcagcccatcctgacggcc
aaggacatggccaacccggaagtggagcacctgggcatcatggcctacgcggcccacctg
cagtgggtgccgccgaggccgccgctctccgacctggtcagcgtttacctggagagcaca
tccggtcgggtgggcgaaccgacccacttccgcatcgacgtaatgtcccgggacataagc
ctcagctctgtgcgctgccacgtggttcctccgtccggacagccgggccagcccgtgcgg
ctgaatgcccacggcgaaggagtctttgtgccggagcgctatgggatgcacgagattgtg
gtggagatcggcgaggacagcctgggcggacacttcttccgtgcgctgccccgtctactg
caggtggcaccaccgggaatggcgccctgtgccttgggcagtctcgtcgaggtgctggtc
aatgccaccggtgcgcccaagacggaggacatcctggtcacggcggtctcgcctacgggc
atctcgcacaattgcccgctgaagaagatcgacgagggacacagtgccatattcaagccg
gacgaggcgggtatctgggaaatagccatcacctaccagggtcgccacatccagggcgga
cccttcacttgtgccgtgttcgatgcatctggagtctcggtccacggcttggatggagcc
atgccgctgagggctcacaccttcgaggtggatgcccgtggagtgggtgtgtctggcgaa
ctgcacgtggacatagtgcacgacaagcattcgctggtctgttcggtggagaagatcgtg
gagaacaagtaccgggtgacctttatgcccaggcagaatgggaagtaccgcgtgtacatc
tacttcaatggctacgatgtcaagggttcgcccttcatcatgcgtgtgggcaccaaggga
agatcgggcaagacgcgcagcagtccgctgcacgacagcaagcaccgctcggagagtccc
tcgatgcacttcgtctcgactacgaatacccggcacaatgactaccgtaactcgtcgctg
tcgaggcacaacacggctgagaggaccaacagctactcgccgcagtattcgcccaagttg
gacaccaccgactaccacagtgcgagttccaggtactataagcgggagagcgaggagaac
cacgccactccgccgccagctccgccaccagttagtggttctccgacggtcaagtaccta
aactccgccgatctgtatacggaaaccctgaacggaagacgagactcgaagacctcgaac
agcagctccacgaagaacgactactactacgacaaggagaacgagctgtacagccagagg
cgtggagtgaccaagcccaagttgacgccaccgcgcgaggagcgcgagctgaccagcacc
agcaataccatgagcagcagcagcagcagcttccagcagcgccaccagcagctggccacc
agtaccctgaccagatcgcttagtccaatacctagtcccacactcaatactcgatccagc
gaggtgcacacccacagtccgttgaccatcaagacgtccaatcagtacgagagttccacg
cggaacatcaacagcagtccgcggcacgcctccgtttcgcccgtgcaacgttattcgccc
aatagcgcctatatcaccacggccactcaccggatgggtagtcccctgaccagtcccgtc
agtaagaatggttacgagtcgtcgcgtaccgtagaaaagtcatccacctacaagtccacc
tcgaactatgtgaccgattcgaatattcgcgccagtccctcgctgtacggaactgccgag
cgactgcgtcgtaccggatcgccggagccacgcatcgaccactcctccaatgtgagggtg
tcctcgatgaagccggccaccgccaggcgggacagctgggatgtcatcaacaagacgaag
cacatgctctcgcacaattcgctcgaatcgctggcgaacatgaccgagaagcagctgaac
acggaactgcagtacaaccggccggatttggatcacgagacgcaccggaacacccagtac
aacaagttcgccctgcacaaacagcagcagcatcagtcggactatcgccgtgactccccc
gatgatggagagcgctacaaacccagtgccattacagtcaagtcacattcgaacaatacc
tatacggacaagtccggtggatacacgaaaaccgtcaaggaatccagcgagcatgtggtt
accgaaagcaacgggcatggctccgcgcctggttacggatacagctccctatccagattt
cgacccatagacagcaatgccactggtgcgcgggccattcgagtgcaggatataccgaat
ggctcgattggacggcccgtcgagttcgagatcgatggctcgagggcgggctccggcaat
ctggagatcctggtcaatggcgggcgtgtcacctcctcggtccgctcgctgggcgggcag
aggttcattgccagcttcacgccccacgaacatggaacgcacacggtgcagatcaccttc
aatggcgaaaccgttccaggttcaccgtggcacgctgaaatcatgtcctcacccggcctg
accgctctgggcgaatcgacgcgcctggtacccgccaatacgccggcggtttttgagata
ctgccgcctcctggacaaagcctgagtaagggcgagtgcgtggcgacggttttgactcct
agcaagtcaaagctgaacgccagagtcacccatgaggcggcaaatggtgctgctcgcatc
gagttcgtgcccaccgaggtgggcacccacgtgatcgatgcgtccatcaacggcacgaag
atcgctggcggcccgctgatcgccaaggtctacgactccagcctgatccaggtgacggag
gtgaatggcggcgtggtcggccagccgtgccaattccgtgtggatgccagcgccgccggc
gagggccagctggagatatccatcaatgagggcgaggtgcccaatcatgtccaggtggtc
ggcggcggtcgctgtctggtctcctttacgccggagcaggccaagtcccatttgattgac
atcaagttcaatggcgaaacggtgcgcggttgtccctttgtctgcgccgtggcggacacc
tcgcgagtgctcctcaatctcaccaatctggagctgatcccggtcaatcggccctcctcc
tttcacatcaccgtgagcggaggtggagctgccgagctggccgtcagtgtgcgcggtccc
cagggcgagttacccgtccgggtgaccggagatatccacgctggcttcaccgccgagttc
acgcccaccaccgtcggtggccattcgatcaacgtcgagtacaacggattcgccgtccag
ggcacccccttcctggccaagtcatacgatgccagcaaggtggtggtgggcagcgtctcg
cggggaaccatgggacgcccggtgcagttcaccgtggatgcgggcgatgccggtgagggc
aacctggagatcacgatttcggccaagggacagaacattcccacgcaggtgcatccgcaa
ggcagtgcaagattttcggtatcctttgtgcccacggagtcgtgcgagcacacgatcaac
gtgtcattcaacaagatgcccgtgcccggctgtccgattacggtcggcatcagtgggggc
gtggccgggccccaggtgtccttgggtggcccaggacccgtgcaccagaccaattctttt
gtaatcaatcacaatggcggccgtttggaggacatcgaggtgaacgtggaaggacggcga
aaacttttgtactag

DBGET integrated database retrieval system