KEGG   Drosophila yakuba: Dyak_GE11838Help
Entry
Dyak_GE11838      CDS       T01068                                 

Gene name
dyak_GLEANR_12136
Definition
(RefSeq) GE11838 gene product from transcript GE11838-RB
  KO
K04437  
filamin
Organism
dya  Drosophila yakuba
Brite
Cytoskeleton proteins [BR:dya04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Dyak_GE11838 (dyak_GLEANR_12136)
  Intermediate filaments
   Intermediate filament-binding proteins
    Dyak_GE11838 (dyak_GLEANR_12136)
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dyak_GE11838 (dyak_GLEANR_12136)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 2992 aa AA seqDB search
MDVKDIKGAKVTHAGLLKHNSDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVENLQTRPLKPSWNRRPANQHHYL
ENATTALKSIEADHIKLVNIGNVDIVNGNIKLILGLIWSLIVRYQIGRSKFPPRKLMLAW
LQAALPDCRITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTQTMDLAQRE
FGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDPVKNFTTDWN
DGRVMCEIIKGLGGSAPAPDKLSTDPFHYENNIRKAVDAGARLGVQPILTAKDMANPEVE
HLGIMAYAAHLQWVPPRPPLSDLVSVYLESTSGRVGEPTHFRIDVMSRDISLSSVRCHVV
PPSGQPGQPVRLNAHGEGVFVPERYGMHEIVVEIGEDSLGGHFFRALPRLLQVAPPGMAP
CALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKPDEAGIWEIA
ITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVSGELHVDIVHDK
HSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKGRSGKTRSSP
LHDSKHRSESPSMHFVSTTNTRHNDYRNSSLSRHNTAERTNSYSPQYSPKLDTTDYHSAS
SRYYKRESEENHATPPPAPPPVSGSPTVKYLNSADLYTETLNGRRDSKTSNSSSTKNDYY
YDKENELYSQRRGVTKPKLTPPREERELTSTSNTMSSSSSSFQQRHQQLATSTLTRSLSP
IPSPTLNTRSSEVHTHSPLTIKTSNQYESSTRNINSSPRHASVSPVQRYSPNSAYITTAT
HRMGSPLTSPVSKNGYESSRTVEKSSTYKSTSNYVTDSNIRASPSLYGTAERLRRTGSPE
PRIDHSSNVRVSSMKPATARRDSWDVINKTKHMLSHNSLESLANMTEKQLNTELQYNRPD
LDHETHRNTQYNKFALHKQQQHQSDYRRDSPDDGERYKPSAITVKSHSNNTYTDKSGGYT
KTVKESSEHVVTESNGHGSAPGYGYSSLSRFRPIDSNATGARAIRVQDIPNGSIGRPVEF
EIDGSRAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGTHTVQITFNGETVPGSP
WHAEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSKSKLNARV
THEAANGAARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTEVNGGVVGQP
CQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIKFNGETVR
GCPFVCAVADTSRVLLNLTNLELIPVNRPSSFHITVSGGGAAELAVSVRGPQGELPVRVT
GDIHAGFTAEFTPTTVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRGTMGRPVQ
FTVDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVSFNKMPVP
GCPITVGISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGPAGQSVPAQVH
QSADGVFKAEFVPRVVGEHRVNVTVNGLPTAGSPYAAKVYDVSAIKVKNVSSGTVGKAVT
FLVETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPREAESHTVELRFNSQDVPGS
PFTCRVAAAARIQSPETMDKISVGRLFEFVVESDTKPTVEVLGPARRSVPVKIDPLGSST
LGYNIKFEPMEVGDHSVEVRLPGGGHVEGSPFLLKAYSAEKVIVTDIRAGVVNKSVSFGI
NASQAGAGNLEIIVAVNGKNVPNFVQSEGNARFKVNFKPTEAATHSLSVRFNGHPVPGSP
FSCHIAAAAASPSMGLPRAMAMGECLKQAAVKMDNTFELEGFEGVEPQIFVTSPSGDNEH
CQLSQHDGGSYSASFRPTTVGRHLISVTANDQHINGSPFSCNVFDVSRVSISGLEQQYGP
ANLGVPVTFSVDAAGAGEGTLELVVSTDSSTVKAEVVACARGLYDVTFVPQSTEPHYVNI
TFNEVAVDGSPFRVDIQQHTQHIQIGSLAAIDFPADDQIVEIFSPDQKSVPYSINRQTAE
FRTHMTGNYTLRFIDRETRQHIGSRTLCVFDPTLVKITEVSEAFCHRPASIGVSLNEAGQ
GDLSALVRCGATEVPHTIRGPSKTGVYEIVYQPTRVAPHKISILFNEVPISLKPLEINVL
PASAGKEISVSGLGLYQSRVGKTTSFAIDTVKRPAREFDVVVSGPGGQALPVRCYQTKNG
HLQAEFTINKPGQCVIEVLHQSKPLPGSPFTCESFDSSKVSTQGVTKEPLALHSPNSFTV
RTDNAGTAELEAFAISPSNQSIPVLISEQSDGVYNVEFVPSQPGNYKLTLMYGGETIPSS
PLNFTASSSGVRNDARAAGHGLEVCHRNKEASFVVYCPIAPNVQIERLDEYGERIEPKIK
ALGNNEWRISYTILSVGKYEIRASCPNRGSLPGSPWHISCVESNKVTPVGGWGTLVDHDG
RLILPARIVFDVENAGPGKLVCSIDGIEIPVDKLVDGKMCLNITGESLAAGEHDLDLTWS
GLTITQCPRSAFVTGQQAADKVQLMGRGLAAAQAGEAAHFTIDASNAPAGRPEVILTSQD
STSLPVSLAQPRPSENIWLASYTPLKSTTGTLNLSVKWNGRLVKGCPLTVAVGSSMDATK
VIASGEGLRHGIVGKDIKSWIDTRRAGPGELTAHCAGVRKVAYCELYDHGDATFTLNIKP
QEPGRHLLTIKYGGQNVPGSPFALKVAGAPDASKVRVYGPGIEHGVLATFQSRFICDTRG
AGAGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRVEVKWAGEFVPGSPFP
VMIFDTEEELRRYLQGIXGQLNHHVIVFPSGLSPLPIRRHQCRRRASTCSPL
NT seq 8979 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaggacataaaaggcgccaaggtgacgcatgcggggctgctcaagcacaac
tccgatggcaccaccgaaacgcagaagatcacccacgcgggtctggtggcccggagtccc
gagggcaccgccgccaagggcatgaacatacggggcaacgaggatctctgggtggagatc
caggcgaatacattccgcaactgggtcaacgagcatttgcgcgagacgggaatgcaggtg
catgactgggccaccgatttctgcgatggcacctgcctgtgcgcccttgtggagaacctg
cagacgcgtccactgaaaccctcgtggaatcgccggcccgcgaatcagcatcactatttg
gagaacgccactacagcgctgaagtccattgaggcggaccacatcaagctggtgaacatc
ggcaacgtggacatcgtcaatgggaacataaagctgatcctgggtctgatctggtcgctc
atcgtgcgctatcagatcggcagaagcaagttcccgccacgcaaactgatgttggcctgg
ctgcaggccgcattgccggactgcaggatcaccaatctgaccaccgattggaatagtggc
gtcaatctggcggcgctgctagactactgccagccgggcctgttcccgcactggcggagt
ctcgatcccagccagagtgtgcgcaactgcacccaaaccatggacttggcccagcgcgag
tttggagtgcccaaggtcctggagccggagtacctggcctcaccctggttggatgagtta
tccggcatgacgtacctctcgtacttcatgaagcccggtggtcctggctacaatgccacc
atgcgatgggtgaatacgcaggtcaaggaccctgtgaagaactttaccaccgactggaac
gatggacgcgtcatgtgcgaaattattaagggactgggtggctcggcgccagcaccggat
aagctcagcaccgatcccttccactacgagaacaacatacggaaggcggtggacgcgggc
gcccgtctgggcgtgcagcccatcctgacggccaaggacatggccaacccggaagtggag
cacctgggcatcatggcctacgcggcccacctgcagtgggtgccgccgaggccgccgctc
tccgacctggtcagcgtttacctggagagcacatccggtcgggtgggcgaaccgacccac
ttccgcatcgacgtaatgtcccgggacataagcctcagctctgtgcgctgccacgtggtt
cctccgtccggacagccgggccagcccgtgcggctgaatgcccacggcgaaggagtcttt
gtgccggagcgctatgggatgcacgagattgtggtggagatcggcgaggacagcctgggc
ggacacttcttccgtgcgctgccccgtctactgcaggtggcaccaccgggaatggcgccc
tgtgccttgggcagtctcgtcgaggtgctggtcaatgccaccggtgcgcccaagacggag
gacatcctggtcacggcggtctcgcctacgggcatctcgcacaattgcccgctgaagaag
atcgacgagggacacagtgccatattcaagccggacgaggcgggtatctgggaaatagcc
atcacctaccagggtcgccacatccagggcggacccttcacttgtgccgtgttcgatgca
tctggagtctcggtccacggcttggatggagccatgccgctgagggctcacaccttcgag
gtggatgcccgtggagtgggtgtgtctggcgaactgcacgtggacatagtgcacgacaag
cattcgctggtctgttcggtggagaagatcgtggagaacaagtaccgggtgacctttatg
cccaggcagaatgggaagtaccgcgtgtacatctacttcaatggctacgatgtcaagggt
tcgcccttcatcatgcgtgtgggcaccaagggaagatcgggcaagacgcgcagcagtccg
ctgcacgacagcaagcaccgctcggagagtccctcgatgcacttcgtctcgactacgaat
acccggcacaatgactaccgtaactcgtcgctgtcgaggcacaacacggctgagaggacc
aacagctactcgccgcagtattcgcccaagttggacaccaccgactaccacagtgcgagt
tccaggtactataagcgggagagcgaggagaaccacgccactccgccgccagctccgcca
ccagttagtggttctccgacggtcaagtacctaaactccgccgatctgtatacggaaacc
ctgaacggaagacgagactcgaagacctcgaacagcagctccacgaagaacgactactac
tacgacaaggagaacgagctgtacagccagaggcgtggagtgaccaagcccaagttgacg
ccaccgcgcgaggagcgcgagctgaccagcaccagcaataccatgagcagcagcagcagc
agcttccagcagcgccaccagcagctggccaccagtaccctgaccagatcgcttagtcca
atacctagtcccacactcaatactcgatccagcgaggtgcacacccacagtccgttgacc
atcaagacgtccaatcagtacgagagttccacgcggaacatcaacagcagtccgcggcac
gcctccgtttcgcccgtgcaacgttattcgcccaatagcgcctatatcaccacggccact
caccggatgggtagtcccctgaccagtcccgtcagtaagaatggttacgagtcgtcgcgt
accgtagaaaagtcatccacctacaagtccacctcgaactatgtgaccgattcgaatatt
cgcgccagtccctcgctgtacggaactgccgagcgactgcgtcgtaccggatcgccggag
ccacgcatcgaccactcctccaatgtgagggtgtcctcgatgaagccggccaccgccagg
cgggacagctgggatgtcatcaacaagacgaagcacatgctctcgcacaattcgctcgaa
tcgctggcgaacatgaccgagaagcagctgaacacggaactgcagtacaaccggccggat
ttggatcacgagacgcaccggaacacccagtacaacaagttcgccctgcacaaacagcag
cagcatcagtcggactatcgccgtgactcccccgatgatggagagcgctacaaacccagt
gccattacagtcaagtcacattcgaacaatacctatacggacaagtccggtggatacacg
aaaaccgtcaaggaatccagcgagcatgtggttaccgaaagcaacgggcatggctccgcg
cctggttacggatacagctccctatccagatttcgacccatagacagcaatgccactggt
gcgcgggccattcgagtgcaggatataccgaatggctcgattggacggcccgtcgagttc
gagatcgatggctcgagggcgggctccggcaatctggagatcctggtcaatggcgggcgt
gtcacctcctcggtccgctcgctgggcgggcagaggttcattgccagcttcacgccccac
gaacatggaacgcacacggtgcagatcaccttcaatggcgaaaccgttccaggttcaccg
tggcacgctgaaatcatgtcctcacccggcctgaccgctctgggcgaatcgacgcgcctg
gtacccgccaatacgccggcggtttttgagatactgccgcctcctggacaaagcctgagt
aagggcgagtgcgtggcgacggttttgactcctagcaagtcaaagctgaacgccagagtc
acccatgaggcggcaaatggtgctgctcgcatcgagttcgtgcccaccgaggtgggcacc
cacgtgatcgatgcgtccatcaacggcacgaagatcgctggcggcccgctgatcgccaag
gtctacgactccagcctgatccaggtgacggaggtgaatggcggcgtggtcggccagccg
tgccaattccgtgtggatgccagcgccgccggcgagggccagctggagatatccatcaat
gagggcgaggtgcccaatcatgtccaggtggtcggcggcggtcgctgtctggtctccttt
acgccggagcaggccaagtcccatttgattgacatcaagttcaatggcgaaacggtgcgc
ggttgtccctttgtctgcgccgtggcggacacctcgcgagtgctcctcaatctcaccaat
ctggagctgatcccggtcaatcggccctcctcctttcacatcaccgtgagcggaggtgga
gctgccgagctggccgtcagtgtgcgcggtccccagggcgagttacccgtccgggtgacc
ggagatatccacgctggcttcaccgccgagttcacgcccaccaccgtcggtggccattcg
atcaacgtcgagtacaacggattcgccgtccagggcacccccttcctggccaagtcatac
gatgccagcaaggtggtggtgggcagcgtctcgcggggaaccatgggacgcccggtgcag
ttcaccgtggatgcgggcgatgccggtgagggcaacctggagatcacgatttcggccaag
ggacagaacattcccacgcaggtgcatccgcaaggcagtgcaagattttcggtatccttt
gtgcccacggagtcgtgcgagcacacgatcaacgtgtcattcaacaagatgcccgtgccc
ggctgtccgattacggtcggcatcagtgggggcgtggccgggccccaggtgtccttgggt
ggcccaggacccgtgcaccagaccaattcttttgtaatcaatcacaatggcggccgtttg
gaggacatcgaggtgaacgtggaaggaccagctggccaatcggttccggcgcaagtgcat
cagtccgccgatggcgtcttcaaggcggagttcgtgcccagagtcgtgggtgagcatcgg
gtcaatgtcacggtcaacggattacccaccgccggaagtccatatgcagccaaggtctac
gatgtcagcgccatcaaggtgaagaatgtgagcagtggcacggtgggcaaggcagtcaca
ttcctggtggagacatcccaggccggacccggcaacctggaggtgaccgtcaacggcggc
cgggtaccgacctcagcccaagcccagggtcagcacacctatgccatcagcttcacgccg
cgcgaggctgagagtcacaccgtggagctgcgcttcaatagccaggatgtaccgggatcc
ccgttcacctgccgcgtggcagctgccgctcgcatccagtcgccggagaccatggacaag
atcagcgtgggtcgactgtttgagttcgtcgtggagtcggacaccaagccgacggtcgag
gtacttggtcctgccagacggagtgtgcccgtgaagatagacccactcggttcgtccacc
ctcggctacaatatcaaatttgagcccatggaagtaggcgaccactcggtggaggttcgt
ctgcccggcggtggtcatgtggagggcagtccctttctgctgaaggcctactccgccgag
aaggtgatagtcacggatatccgtgctggcgtggtcaacaagagtgtgagcttcgggatc
aatgcctcgcaggcgggtgccggcaatctggagattattgtggccgtcaatggcaagaac
gtgcccaactttgttcaatccgagggcaatgcccgattcaaggtgaacttcaagcccacg
gaggcggctacccactcgctgtcggtgcgattcaatggacatccggtgccgggttcacca
ttcagctgtcacatcgccgctgccgccgcttcgccctcgatgggattgccacgggccatg
gccatgggagaatgcctgaagcaggcggccgtcaagatggacaacacctttgagctggag
ggctttgagggcgtggagccgcagatctttgtgacctcgccatcgggcgacaatgagcac
tgccagttgagccagcacgacggaggcagttactccgcctcattccgccccaccaccgtg
ggtcgtcacctgatcagtgtgacagctaacgatcagcacatcaacggatcacccttcagc
tgcaacgtgttcgacgtctccagggtgagcatcagtggactggagcagcagtatggaccg
gccaacctgggcgttccagtcaccttcagcgttgacgctgccggcgctggagagggaacc
ctggagctggtggtgtccaccgacagcagcaccgttaaggcagaggtggtggcctgtgcc
cgtggtctgtacgacgtgacctttgtgccccagagcacggaaccccactacgtgaacatc
accttcaacgaggtggccgtggatggaagtcccttccgcgtggacatccagcagcacacg
cagcatatccagatcggtagtttggcggccattgattttccagcggacgatcagatcgtt
gagatattctcgccggatcagaagtcggttccgtattcgattaaccggcagacggccgag
ttccggacccacatgaccggcaactacaccttgcgctttatcgatcgggagacccgtcag
cacattggatcgcgcactttgtgcgtctttgatcccacgctggtgaagatcaccgaggtg
agcgaggccttctgccatcgtcctgccagcattggtgtgtccttaaacgaagctggccag
ggtgacctatcggctctggtgcgttgtggcgccaccgaagtgccgcacaccattcgcgga
cctagcaaaactggagtgtatgagatagtttaccagcccacgcgtgtggctccacacaag
atcagcatcctcttcaacgaagtgcccatttcgctgaaaccgctggagatcaatgtgctg
cccgccagtgctggcaaggagatcagcgtcagtggactgggcttgtatcagtcgcgagtg
ggcaagaccacttcctttgccatcgacacagtcaagaggccagccagggagttcgatgtg
gtggtctccggaccaggcggacaagctctaccggtgcgatgttatcagaccaagaacgga
cacctgcaggcggagttcaccatcaacaagcccggacagtgtgtcattgaggtactccac
caatcgaagcccctgcccggcagtccatttacgtgtgaatcctttgacagcagcaaggtc
agcacacaaggggtcaccaaggaaccactggccctacacagtccaaatagtttcacagta
cgcacggataatgccggaaccgctgaactggaggctttcgccatctcgcccagcaatcag
agcattcccgtgctcattagcgagcaatcggatggcgtctacaacgtggagtttgtgccc
tcgcagccgggcaactacaagctgacccttatgtacggaggcgagacgattcccagctcg
ccgctgaactttaccgcctcgtccagtggcgtccggaatgacgcccgtgcagctggacac
ggactggaggtgtgccaccggaacaaggaggcatccttcgtggtctactgccccattgcg
ccaaatgtgcagatcgaacgattggacgagtatggtgagcggatagagcccaagatcaag
gcactgggcaacaatgagtggcgcatctcgtacacaattctgtccgtgggcaaatacgag
atacgcgccagctgtccgaaccgcggaagcttgccgggttcgccgtggcacatcagttgc
gtggaatcgaacaaggtgacaccggtgggtggttggggcaccctcgttgatcacgatggc
cggctgattctgcccgctcgcattgttttcgatgtggagaacgcgggaccgggcaaactg
gtttgcagcatcgatggcatcgaaatacccgtggacaagttggtcgacggcaagatgtgc
cttaacatcacgggcgagagcctggccgccggcgagcatgacttggatttgacctggagc
ggcctgaccatcacccagtgccccaggagtgccttcgtcacaggtcaacaggcggcggat
aaggttcagctaatgggtcgcggtctggctgcagctcaggctggcgaggctgcccacttc
acgatcgatgcctccaatgcgccggctggcaggccggaggtgatcctcaccagccaggac
agcacatcgctgccagtgagtctggcgcaaccgagaccaagcgagaacatctggctggcc
tcctacactccgctgaagtccacaactggcactctaaatctatctgtcaagtggaacggt
cgtttggtcaagggatgtccgcttacggtggcagtgggctcttcgatggatgccaccaag
gtaatagcctccggcgagggactgcgtcacggcattgtgggcaaggacattaagtcctgg
atagacaccaggcgtgcaggacccggcgaactcaccgcccattgtgctggtgttcgtaaa
gtggcctactgtgaactatacgatcatggcgatgccacatttaccctgaacatcaagccc
caggaaccaggtcgccatctgctgaccatcaagtacggcggacaaaatgttcccggctcg
ccatttgccctgaaagtggccggtgcaccggatgccagtaaggtgcgcgtttatggacct
ggtatcgagcacggcgtgctggccaccttccagtcgcgcttcatctgcgacacccgagga
gctggagctggtcagctgacagttcgggtacgcggacccaagggcgccttccgcgtggag
atgcagcgtgagagccagaaggatcgcaccatcctgtgcaagtacgatccaaccgaaccg
ggtgactatcgcgttgaggtgaaatgggcgggcgaattcgtgccaggatcgccgttcccc
gtcatgatcttcgacactgaggaggagttacggcggtacttacagggcatatgaggccag
ctcaaccaccatgtcatcgtcttccccagtggcctcagtccgctgcccattaggcgccat
caatgtcgacggcgtgcctccacttgctctcccctctag

DBGET integrated database retrieval system