KEGG   Drosophila yakuba: Dyak_GE21182Help
Entry
Dyak_GE21182      CDS       T01068                                 

Definition
GE21182 gene product from transcript GE21182-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dya  Drosophila yakuba
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dyak_GE21182
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dyak_GE21182
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE21182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 576 aa AA seqDB search
MTEGKNLPHSSADVPFRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHR
VELSVITPQDGWYEQDPLEMMASINKCAEEAIKQLPENGFSASDIVTVGITNQRETTIVW
DAVTGKPLYNALLWKDIRTSTTVEQIVAKVQDPNHFRSSTGLPISTYFSALKIRWLRDNV
PEVRQAIRERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLETQAWDPVLLKTFG
IREEMLPAIHSCSEVFGKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSG
CFLLCNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSWLQNKVRILPDS
RDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQNARGIIIGLTQFTRKNHIVRAALESICF
QTRDILECMHQECGYEINKLHADGKLTTNNLLMQLQADTIGMPVFRSQLMDSTAFGAAMC
AAQADGVNLCQFEPEKRYYENVHYDTFLATTTDVERKERYGKWKRAVERSLGWVIKQKKT
REYTEENYRMMSSLPASIFLISSFAMLVHSLAASGQ
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagggcaagaacttaccccactccagtgcggatgtgccgttccgcagcaaggag
ctgcgcaagcagtcgctcatccagcacaccggcctggtcggagtcatcgatgagggcacc
aagaccatcggcttctccatctacaccacgccggacttcaaggagatcgccgcacaccgg
gtggagctgagcgtgatcacgccccaggatggctggtacgagcaggacccgctggagatg
atggcctcgatcaacaagtgcgccgaggaggccatcaagcaattgcccgaaaacggtttc
tccgccagcgacatcgtcaccgtgggcattaccaaccagcgcgagacaacgatcgtctgg
gatgcggtcaccggcaaaccgctgtacaatgcgctcctgtggaaggacatccgcactagc
actacagtggagcagatcgtggccaaggtgcaggatccgaaccactttcgcagcagcacg
ggactgcccatctccacgtacttctcggccctcaagatccgctggctgcgggacaatgtt
cccgaggtgcggcaggccatccgcgaaaggcgttgcaaggcgggcacagtcgacagctgg
atcgtctggaacttgacaaacggagctctccacatcacggatgtgacgaacgcctcccgc
actctgctcatgaatctggaaacgcaagcctgggatcccgttctgctcaagacgttcggc
atcagggaggagatgctgcccgccatccacagctgttcggaggtatttggcaagatcaca
tcggagcgaagtccgctgcgtggaatgaccctgagtggaataatgggcaaccagcaggcc
tcgctactgggccagatgtgcgtgaagccgggccagacgaagaacacttaccggtccggc
tgcttcctgctctgcaataccggagacaagcccgtcttctccaggcacggtctgctcacc
accgtggcttacaagctcggtccacaggcaccgacgatctacgccattgagggagctgtt
tcggtggccggacatgcgctctcctggctgcaaaacaaggtgcgtatcctgccggactcc
agagatgccgagaaatatgcggagatggtgcccacatcgggagacgtgtacttcgtgccc
gccttcacaggactatatgcaccctactggcggcagaatgctcgaggcatcatcattggg
ctcacgcagttcacccgtaagaatcacatagtgagggctgcactggagagtatctgcttc
cagacgcgcgacatcctggagtgcatgcaccaggagtgcggttacgagataaacaagctc
catgctgacggcaagcttaccacgaacaacctgttgatgcaactgcaggcggacaccatt
ggtatgcccgtcttccgctcccagctaatggactccacggccttcggagctgccatgtgc
gcagcccaagcagatggtgtcaatctctgccaattcgagcccgagaagcgatactacgag
aacgtgcactacgacacgttcctggccaccaccacggatgtagagcgcaaggagcgttac
ggcaagtggaagcgggcggtggagcgcagcctgggatgggtgatcaagcagaaaaagacg
cgggagtacacggaggagaactaccgcatgatgtcctcgctgccagcgagcatcttcctc
atcagcagcttcgccatgctggtgcattccctcgctgcgagtggccagtaa

DBGET integrated database retrieval system