KEGG   Drosophila yakuba: Dyak_GE21758Help
Entry
Dyak_GE21758      CDS       T01068                                 

Definition
GE21758 gene product from transcript GE21758-RA
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dya  Drosophila yakuba
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dya00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 186 aa AA seqDB search
MVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADAYQSDNTLTELRAKR
GYTYDDEITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILDGSGYFDVRDNEDNWLRIKV
VKGDLIIIPAGIYHRFTLDTNNFIRTRRYFVGEPVWAPHNRPADDMDCRKSYIKHQSENF
VQFNKV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagtttggtatatggacacggaggaaaccgaccagcgcctggagcaccaccgc
aatccgcctgcctacttggaactggatgatctttaccagaagaccggcgtggaatacttc
aagatcaatgcggacgcgtaccagagcgataacaccctcaccgaactgagggcaaaacgt
ggctacacctacgatgatgagatcacctgctccgaaaagtgccttccagactatgccaac
aagttgaaagcctttttcaccgaacacctgcacacggatgaggaaattcgcctgatattg
gatggatctggttacttcgatgtgcgcgacaatgaggacaattggctgcgcattaaggtt
gtgaagggagatctgatcattatacccgcgggcatctatcaccgcttcactttggatacc
aataactttatcagaactcgtcgttattttgtgggggaacctgtgtgggctccacacaac
cgtcctgctgatgacatggactgtcgcaagtcgtacatcaagcatcagtcggaaaacttt
gtgcaattcaacaaggtctaa

DBGET integrated database retrieval system