KEGG   Drosophila yakuba: Dyak_GE23365Help
Entry
Dyak_GE23365      CDS       T01068                                 

Gene name
dyak_GLEANR_7159
Definition
(RefSeq) GE23365 gene product from transcript GE23365-RA (EC:2.7.11.-)
Organism
dya  Drosophila yakuba
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 354 aa AA seqDB search
MSQHTTQYVFNSKEDYNITLDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVM
LVREKGGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYL
ILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHRMHLMYRDLKPENILLDQRG
YIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPF
AIHNRDVILMYSKICVCDYKMPSYFTAQLRSLIESLMQVDTTKRLGNSNEGASDVKGHPW
FQGVDWFGILNQEVTAPYLPTVSGAEDLSNFENFEFKDRYKSRINRHPELFANF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcacactacgcagtacgttttcaactcaaaggaagactacaacatcacccta
gacaacatgagtcgcgagttcgaagagcggtggaaccaccagacccagtcgccctacacc
aacctggagaactatataaccagggccgttctcggcaacggaagttttggcactgtgatg
ctggtcagggagaagggtggcaagaactactatgccgccaagatgatgagcaaggaggat
ctggtgcggctgaagcaggtggcccacgtacacaacgagaagcacgtcctgaatgccgcc
cgattcccgttcctcatctacctggtggactcgacgaagtgctttgactacctctacctg
atcctcccgctggtcaatggaggtgagctgttcagctaccatcgcagagttcgcaagttc
aacgagaagcatgccagattctatgccgcccaggtggcactggccctcgagtatatgcac
aggatgcacctcatgtaccgtgatctgaagccggagaacattctgctcgatcagcgcggc
tacatcaaaatcacggactttggtttcacaaagcgtgtggatggccgcacctcaacgctg
tgtggaaccccggagtacctggccccggagatcgttcaactccggccgtataacaaatcg
gtggactggtgggccttcggtatcctggtgtacgagtttgtggcagggcgctctcccttc
gccattcacaatcgagatgttattctgatgtactccaagatctgcgtgtgcgactacaag
atgccctcatactttacggcccagctgaggagtctcatcgagagtctcatgcaggtggac
accaccaagcgtttaggaaactcgaacgagggcgccagtgacgtgaagggtcatccgtgg
ttccagggcgtggattggtttggcattcttaaccaggaggtcaccgccccctacttgcca
actgtttccggtgccgaagatctgtccaactttgagaacttcgagttcaaggatcggtac
aagtcccgaataaaccgccatcccgaattgtttgcgaatttttaa

DBGET integrated database retrieval system