KEGG   Durio zibethinus (durian): 111277296Help
Entry
111277296         CDS       T05242                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00052  Galactose metabolism
dzi00500  Starch and sucrose metabolism
dzi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    111277296
   00500 Starch and sucrose metabolism
    111277296
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111277296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 111277296
NCBI-ProteinID: XP_022719387
Position
Unknown
AA seq 647 aa AA seqDB search
MVDTNPFLPVSSSDGSYPTGPQITHRKPIKEHLTIFFGLLAVGLFAALLIGNNGSDNGHV
HENQHGSLASSSSKKPEPLQPVSRGPAAGVSEKSNRLSANVNGNLPAYPWNNSMLSWQRT
SFHFQPEKNWMNDPNGPMFYKGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLHLPLAM
VADQWYDQNGVWTGSATILPNGKIVMLYTGSTVEAVQVQNLAYPADHSDPLLVHWVKYPG
NPVLVPPPGTYKKDFRDPTTAWLTSEGKWRITIGSKINKTGIALIYDTKDFINYEKLDGV
LHAVPGTGMWECVDFFPVSKTEENGLDTSVNGPGVKHVVKVSLDDDRHDYYAIGTYHEKN
GTWIPDQPEIDVGIGIRYDYGIYYAAKTFYDQNKNRRVLWGWIGESDSEAADMKKGWASV
QSIPRTILFDKKTGTHLLQWPVEEIESLRLKSNEFNQVSLLPGSVVPLDVGPATQLDILA
EFEIDKELLKKATGSNITFSCSASGGAAERGALGPFGLLVLADESLSEQTPVYFYITKGS
DGNLKTSFCNDQSRSSAASDVNKQIYGSFLPVLKGENLSLRVLVDHSIIESFAQGGRTVI
TSRLYPTKAIYEAAKVFLFNNATNASVTASLKIWQMNSAFIRPYPNK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggtggatacaaatccattccttccagtctccagctctgatgggtcttatccaacaggg
cctcagataactcaccggaaacccatcaaagagcatcttacaatcttttttgggttgtta
gcggttggcttgtttgcagcattgttgataggaaacaatgggtcagataatggtcatgta
catgaaaatcaacatggttcattggcttcatcgagctccaaaaaacccgaacctttgcag
ccggtgtcacgtggcccggctgccggagtatcggagaaatccaacaggctttccgccaac
gttaacgggaatttaccggcgtatccatggaataatagcatgttgtcatggcaaagaaca
tcttttcattttcaaccagaaaagaattggatgaatgatcctaacggaccaatgttctac
aagggatggtaccatttcttctaccaatacaaccccaatgctgccgtgtggggtgatata
gtttggggtcatgcagtatccaaggacttgatccattggcttcacctcccattagcaatg
gttgctgaccaatggtacgatcaaaatggcgtctggactggttctgccacaattctccct
aatggaaaaattgtaatgctctacacaggatcgaccgtggaggctgttcaagttcaaaac
cttgcttaccctgctgaccactctgaccctctcctcgtccattgggtcaagtatcctggg
aaccctgttctagttccaccaccaggcacctataagaaggatttccgtgacccaactaca
gcctggttgacctctgaagggaagtggcgcattaccatagggtccaagataaataaaact
ggcatagctttgatatatgataccaaggacttcataaactacgagaagttagatggggta
cttcatgctgtgcccggcactggcatgtgggaatgtgttgacttctttcctgtgtcaaaa
acagaagaaaatggcttggacacatccgtaaatggacctggagtgaagcatgtggtcaag
gtaagcctcgatgatgacaggcatgactactatgctattgggacatatcatgagaagaat
ggtacatggattcctgaccaacctgaaattgatgttggcattggaataaggtatgattat
ggaatatactatgctgccaagactttctatgatcagaacaaaaacagaagagtgttgtgg
ggttggattggagaatctgatagtgaagccgctgatatgaagaaaggatgggcatctgtc
cagagcatcccaaggacgattttgtttgacaagaagactggtactcatttgcttcaatgg
ccagtggaagaaatagagagtttaaggttgaaaagcaatgaatttaaccaggtgtcactc
ctgccaggatcagttgttcctctagatgttggtccagccacacagttggatattttagcc
gagtttgagatagataaagagcttttgaagaaagcaacagggtccaacataacattcagc
tgcagtgcgagtggaggagctgcagaacgtggggcattgggaccatttggtcttctggtg
cttgcagatgagagcctcagtgagcagactccggtatacttctacattaccaaaggatct
gatggcaatctcaagacttccttctgcaatgatcaatcccgatcatccgcagcgtcggat
gttaataaacaaatttatgggagcttccttccagttctaaaaggcgaaaacttatccctc
agagtattggtggatcattcgataattgaaagctttgctcaaggcggaaggacagtcatc
acatctcgtctttatccgacaaaagcaatctatgaagctgctaaagtgtttttatttaac
aatgctactaatgccagtgttaccgcctcacttaagatctggcaaatgaactctgcattc
attcggccctatccaaataaatga

DBGET integrated database retrieval system