KEGG   Klebsiella aerogenes KCTC 2190: EAE_13000Help
Entry
EAE_13000         CDS       T01529                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:eae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EAE_13000 (recR)
DNA repair and recombination proteins [BR:eae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     EAE_13000 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EAE_13000 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH FYVE_2 HHH_5 Toprim_2
Motif
Other DBs
NCBI-GeneID: 10792810
NCBI-ProteinID: YP_004592793
UniProt: A0A0H3FS80
Position
2782014..2782619
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQYSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEAESISELILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaactcagcttatggaagcgctgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgcatggcgtttacgctgctgcagcgcgatcgcagcggcggt
atgcgtctggcgcaggcgctaacgcgcgcgatgtcggaaatcggccactgcgccgattgc
cgcaccttcaccgagcaggaggtgtgcaatatttgcagcaacccgcgtcgccaggaaaac
ggtcagatctgcgtggtggagagtccagcggacatttacgccattgagcagaccgggcag
tattccggccgctacttcgtgctgatgggccacctgtcgccgcttgacggtatcgggccg
gatgacatcgggcttgaccgcctcgagcagcgcctcgaagccgagtcaatcagcgagttg
atcctcgcaaccaacccaacggttgaaggcgaggcgacggccaactacatcgctgagctc
tgcgcgcagtatggcgttgacgccagccgcatcgcccacggcgtaccggttggcggcgag
ctggaaatggtcgacggcaccacgttgtcgcactcactggccgggcgccacaagattatt
ttctga

DBGET integrated database retrieval system