KEGG   Enterobacter aerogenes KCTC 2190: EAE_13000Help
Entry
EAE_13000         CDS       T01529                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EAE_13000 (recR)
DNA repair and recombination proteins [BR:eae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EAE_13000 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2782014..2782619
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQYSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEAESISELILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaactcagcttatggaagcgctgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgcatggcgtttacgctgctgcagcgcgatcgcagcggcggt
atgcgtctggcgcaggcgctaacgcgcgcgatgtcggaaatcggccactgcgccgattgc
cgcaccttcaccgagcaggaggtgtgcaatatttgcagcaacccgcgtcgccaggaaaac
ggtcagatctgcgtggtggagagtccagcggacatttacgccattgagcagaccgggcag
tattccggccgctacttcgtgctgatgggccacctgtcgccgcttgacggtatcgggccg
gatgacatcgggcttgaccgcctcgagcagcgcctcgaagccgagtcaatcagcgagttg
atcctcgcaaccaacccaacggttgaaggcgaggcgacggccaactacatcgctgagctc
tgcgcgcagtatggcgttgacgccagccgcatcgcccacggcgtaccggttggcggcgag
ctggaaatggtcgacggcaccacgttgtcgcactcactggccgggcgccacaagattatt
ttctga

DBGET integrated database retrieval system