KEGG   Enterobacter asburiae LF7a: Entas_1640Help
Entry
Entas_1640        CDS       T01604                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00520  Amino sugar and nucleotide sugar metabolism
eas01100  Metabolic pathways
eas01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Entas_1640
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Entas_1640
Enzymes [BR:eas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Entas_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AEN64381
UniProt: G2S8E4
Position
1779120..1780145
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGFELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNQLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGTEEGGKLAQDAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHEDPRIALEMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETP
RDPRPEAEIRAKDMSVFRSLITDNKLDAIMPAHVIYSDVDPRPASGSAHWLKTVLRQELG
FNGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPINAERV
TQLYHKGSFSRQELMGSARWKTVNAQLEALNERWLAHKAGL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccagtcatgttggatgtcgaaggctttgagctggatgcggaggagcgcgaaatt
ctggcgcacccgctggtcggtggcctgattctgtttacccgcaactatcacgacccggag
cagttgcgggaactggttcgacaaattcgcgcggcgtcacgcaatcagctggtggtggcg
gtagaccaggaaggcggtcgcgtgcagcgttttcgcgagggctttacccgcctgccagca
gcgcagtctttcgccgcgctgctgggcaccgaagagggcggcaagctggcgcaggatgcc
ggctggctgatggcaagtgaaatgattgcgatggatattgatatcagctttgcccccgtg
ctggatgtcgggcacattagcgctgctattggtgagcgttcataccatgaagatccgcgc
atcgcactggaaatggccacacgttttattgacgggatgcacgatgccgggatgaaaacc
accggtaaacacttcccggggcacggggccgtcacggcggattctcacaaagaaaccccg
cgcgacccacgccctgaagcggagatccgcgccaaagatatgtcagtgttccgctcgctt
atcaccgataacaagcttgatgccatcatgccggcacatgttatttacagcgatgtcgat
ccacgcccggcgagcggctctgcccactggctgaaaaccgtgctgcgtcaggaattaggc
tttaacggcgtgatcttctctgacgatttgtcgatggaaggtgctgccattatgggcagc
tatgctgaacgcggacaggcatcgctggatgcaggttgcgatatgatcctggtctgcaat
aatcgtaaaggcgcagtcagtgtgttggataacctgtcgccgatcaatgctgagcgtgtt
acacaattgtatcataaaggttcatttagccgtcaggagctgatgggctcggcgcgctgg
aagacggtcaatgctcagcttgaggcgctgaatgagcgctggctggcgcataaagcaggc
ctttaa

DBGET integrated database retrieval system