KEGG   Erwinia amylovora ATCC 49946: EAM_0103Help
Entry
EAM_0103          CDS       T01199                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAM_0103 (pfkA)
   01230 Biosynthesis of amino acids
    EAM_0103 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAM_0103 (pfkA)
   00030 Pentose phosphate pathway
    EAM_0103 (pfkA)
   00051 Fructose and mannose metabolism
    EAM_0103 (pfkA)
   00052 Galactose metabolism
    EAM_0103 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EAM_0103 (pfkA)
Enzymes [BR:eay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EAM_0103 (pfkA)
Protein phosphatases and associated proteins [BR:eay01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EAM_0103 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131299..132261
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVCGIYDGYLGLYEDRMINLDRYSVSD
MINRGGTFLGSARFPEFRHEDVRSVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIPYTREELVGEIKAGIAKGKKHAIVAITEHICDIDDLAKYIEQETK
RETRATVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaatcggtgtactgaccagtggtggcgatgccccaggcatgaatgctgcg
atccgcggtgttgtgcgcgccgcccttagcgaaggtcttgaagtttgcggcatttatgac
ggctatctgggtttgtatgaagaccgcatgatcaatctcgaccgctacagcgtgtcggat
atgatcaaccgcggcggtactttcctgggctccgcgcgcttcccggagtttcgccatgag
gacgtgcgcagcgtcgccatcgaaaacatgaagaaacgtggtatagacgcactggtagtg
atcggcggtgacgggtcttatatgggggccaagcgcctgaccgaaatgggcttcccatgt
attggactgccgggcactattgataacgacgtggccggcaccgattacaccattggctat
tttaccgcgctggaaaccgtggtggaggctatcgaccgtctgcgtgatacttcgtcctcg
caccagcgtatttctatcgtcgaggttatggggcgttactgtggcgatctgacgctggca
gcggcgattgccggtggctgtgagtttatcgtgctgccggaaattccttatacccgtgaa
gagctggtgggtgagatcaaagccgggattgccaaaggtaaaaaacatgcgatcgtggcg
attacggaacatatctgcgatatcgacgatttggcgaaatatatcgaacaggaaaccaaa
cgtgaaacgcgcgcgacggtgctgggtcatattcagcgcggcggcgctccggttgcttat
gaccgtattctcgcgtcacgcatgggtgcctactcgatagaactgctgttacagggctac
ggtggccgctgtgtcggcattcagaacgagaagatggtgcatcacgatattatcgacgcg
atcgaaaacatgaaacgtccgtttaaaggtgactggctggatactgccaagaaactatac
tga

DBGET integrated database retrieval system