KEGG   Escherichia coli B REL606: ECB_01782Help
Entry
ECB_01782         CDS       T00944                                 

Gene name
pabB
Definition
(GenBank) para-aminobenzoate synthase component I
  KO
K01665  
para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
ebr  Escherichia coli B REL606
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECB_01782 (pabB)
Enzymes [BR:ebr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     ECB_01782 (pabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
1873384..1874745
Genome map
AA seq 453 aa AA seqDB search
MKTLSPAVITLPWRQDAAEFYFSRLSHLPWAMLLHSGYADHPYSRFDIVVADPICTLTTF
GKETVVSESEKRTTTTDDPLQVLQQVLDRADIRPTHNEDLPFQGGALGLFGYDLGRRFES
LPEIAEQDIVLPDMAVGIYDWALIVDHQRHTVSLLSHNDVNARRAWLESQQFSPQEDFTL
TSDWQSNMTREQYGEKFRQVQEYLHSGDCYQVNLAQRFHATYSGDEWQAFLQLNQANRAP
FSAFLRLEQGAILSLSPERFILCDNSEIQTRPIKGTLPRLPDPQEDSKQAEKLANSAKDR
AENLMIVDLMRNDIGRVAVAGSVKVPELFVVEPFPAVHHLVSTITARLPEQLHASDLLRA
AFPGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSFCGNMDTSITIRTLTAINGQIY
CSAGGGIVADSQEEAEYQETFDKVNKILRQLEK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgttatctcccgctgtgattactttaccctggcgtcaggacgccgctgaattt
tatttctcccgcttaagccacctgccgtgggcgatgcttttacactccggctatgccgat
catccgtatagccgctttgatattgtggtcgccgatccgatttgcactttaaccactttc
ggtaaagaaaccgttgttagtgaaagcgaaaaacgcacaacgaccactgatgacccgcta
caggtgctccagcaggtgctggatcgcgcagacattcgcccaacgcataacgaagatttg
ccatttcagggcggcgcactggggttgtttggctacgatctgggccgccgttttgagtca
ctgccagaaattgcggaacaagatatcgttctgccggatatggcagtgggtatctacgat
tgggcgctcattgtcgaccaccagcgtcatacagtttctttgctgagtcataatgatgtc
aatgcccgtcgggcctggctggaaagccagcaattctcgccgcaggaagatttcacgctc
acttccgactggcaatccaatatgacccgcgagcagtacggcgaaaaatttcgccaggta
caggaatatctgcacagcggtgattgctatcaggtgaatctcgcccagcgttttcatgcg
acctattctggcgatgaatggcaggcattccttcagcttaatcaggccaaccgcgcgcca
tttagcgcttttttacgtcttgaacagggtgcaattttaagcctttcgccagagcggttt
attctttgtgataatagtgaaatccagacccgcccgattaaaggcacgctaccacgcctg
cccgatcctcaggaagatagcaaacaagcagaaaaactggcgaactcagcgaaagatcgt
gccgaaaatctgatgattgtcgatttaatgcgtaatgatatcggtcgtgttgccgtagcc
ggttcggtaaaagtaccagagctcttcgtggtggaacccttccctgccgtgcatcatctg
gtcagcactataacggcgcgactaccagaacagttacacgccagcgatctgctgcgcgca
gcttttcctggtggctcaataaccggggctccgaaagtacgggctatggaaattatcgac
gaactggaaccgcagcgacgtaatgcctggtgcggcagcattggctatttgagcttttgc
ggcaacatggataccagcattactatccgcacgctgactgccattaacggacaaatatac
tgctctgcgggcggtggaattgtcgccgatagccaggaagaagcggaatatcaggaaact
tttgataaagttaataagatattacgccaactggagaagtaa

DBGET integrated database retrieval system