KEGG   Equus caballus (horse): 100062906Help
Entry
100062906         CDS       T01058                                 

Gene name
USP35
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 35
  KO
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100062906 (USP35)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100062906 (USP35)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100062906 (USP35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
7
AA seq 1013 aa AA seqDB search
MDKILEAVVTSSYPASVKQGLVRRVLEAARQPLEREQCLALLALGARLYVTGADELPRRV
GCQLLHVAGRHHPDVFAEFFSARRVLRLLQGGAGPPGVRALACVQLGLQLMPEGPAADEV
LAVLRRELLRTVCERPGPAACAQVARLLARHPRCVPEGPHRLLFCQQLVRCLGRFRCPAE
GEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCTEEEPPSSALASVVQHL
PLELMDGVVRNLSNDDSVSDSQMLTAISRMIDWVSWPLGKNIDKWIIALLKGLAAVKKFS
ILIEVSLAKIEKVFSKLLYPIVRGAALSVLKYMLLTFQHSHEAFHLLLSHIPPMVASLVK
EDSNSGTSCLEQLAELVHCMVFRFPGFPDLYEPVMEAIKDLHVPNEDRIKQLLGQDAWTS
QKSELAGFYPRLMAKSDTGKIGLINLGNTCYVNSILQALFMASDFRHCVLRLTENNSQPL
MTKLQWLFAFLEHSQRPAISPENFLSASWTPWFSPGTQQDCSEYLKYLLDRLHEEEKTGT
RIYQKLKQSSLPSPPEEPPSPTSTSVEKMFGGKIMTRICCLHCLNVSSREEAFTDLSLAF
PPAERCRRRRLGSVMFPAEDIGARDPPSPSRAQVPSRAGPRRQRKHCITGGAPPAVLDIE
GLGPQGPWEQRSQEEKVEKEEEAKEERVEEKEERAEEKETSRGEGEREKEKDKEAEEEKV
EKEKEAENEKKKAEDSLGPGTNRAAATSPGEGSRSVLDLVNYFLSPERLTAENRYYCESC
ASLQDAEKVVELSQGPRYLILTLLRFSFDLRTMRRRKILDDVSIPLLLRLPLAGGHGQAY
DLCSVVVHSGVSSESGHYYCYAREGAARPAPSVGTAERPEPENQWYLFNDTRVSFSSFES
VSNVTSFFPKDTAYVLFYRQRPGEGPEAEPGSPRVRAEPTLHKDLMEAISKDNILYLQEQ
EKEARSRAAYISTLPSSPRWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggaggcggtggtgacgtcgtcgtacccggcgagcgtgaagcagggg
ctggtgcggcgcgtgctggaggcggcgcggcagccgctggagcgggagcagtgcctggcg
ctgctggcactgggcgcgcgcctctacgtgaccggcgccgacgagctgccgcgccgcgtg
ggctgccagctgctgcacgtggcgggccgccaccaccccgacgtcttcgccgagttcttc
agcgcgcgccgcgtgctgcgcctgctgcaggggggcgccggcccgccgggcgtgcgcgcc
ctcgcctgtgtgcagctcggcctgcagctcatgcccgaggggcccgcggccgacgaggtg
ctggcggtgctgcggcgcgagctgttgcgcaccgtgtgcgaacgcccggggcccgcggcc
tgcgcgcaggtggcgcggctgctggcgcggcacccgcgctgcgtccccgaaggcccgcac
cgcctgctcttctgccagcagctggtgcggtgcctcggccgcttccgctgcccggccgag
ggcgaagagggcgccgtggagttcctggagcaggcccagcaggtgagcgggctcctggcg
cagctgtggcgtgcgcagcccgccgccatcctgccctgcctcaaggagctcttcgcggtc
atctcctgcacagaggaggagcctccatccagcgccctggccagtgtggtccagcacctg
ccattggaacttatggatggcgtcgttcggaacctcagcaatgatgacagtgtgtcggac
tcccagatgctgactgccatcagcaggatgatcgactgggtgtcctggcccctggggaag
aacattgacaagtggatcattgcactgctgaagggcctggccgctgttaagaagttcagc
atcttgatcgaggtttcactcgccaaaattgagaaggttttctccaagcttctgtacccc
attgtccggggagccgccttgtctgtcctcaagtacatgctcctgaccttccagcactcc
catgaggccttccatctgctcctctctcacatcccccccatggtggcctccctggtcaag
gaggactccaactcggggaccagctgcctcgagcagttggcagagctggttcactgcatg
gtgttccggttcccgggcttcccagacctctacgagcccgtcatggaggccatcaaggac
ctccatgttcccaatgaggaccgcatcaagcagctgctggggcaggatgcctggacctct
cagaagagtgagctggctggcttctacccccggctcatggccaagtccgacacgggcaag
attggtttaatcaatctgggcaacacgtgctacgtgaacagcatccttcaggccttgttc
atggcttccgacttcagacactgtgtgctccgtttgactgagaacaactcacagcccttg
atgaccaagctgcagtggctctttgccttcctggagcacagccagcggcctgccatttct
ccagagaacttcctctctgcatcctggacaccctggttcagccccggcacccagcaggac
tgctcagagtacctgaagtacctgctggatcggctgcacgaagaggagaaaacggggaca
aggatctaccagaagctcaagcagtccagcttgccctccccacccgaggagccccctagc
ccaacttcaacgtctgtggagaagatgttcggaggcaagatcatgactcggatatgctgt
ctacactgcctcaatgtatcctccagggaggaggccttcacagacctctctcttgccttt
ccgcccgctgagcgctgtcgccgccgccgcctgggctcagtgatgttccctgcagaggac
attggagcccgggaccccccatcgccatcccgagcccaggttccaagcagggcaggtcct
cggaggcagaggaaacactgcatcacagggggtgcccccccagctgtcctggacattgaa
ggcttgggcccccagggaccctgggagcagagaagtcaggaggagaaagtggagaaggag
gaggaagcgaaggaggagagagtggaggagaaggaggagagagcagaggaaaaggagaca
agtagaggagaaggagaaagagagaaggagaaagacaaagaagcggaggaggagaaggtg
gagaaggagaaggaggctgagaacgaaaagaagaaggcagaggacagcctgggaccaggg
accaacagggctgctgccacctcccctggggagggctcccgctccgtgttggacctggtc
aactacttcctgtcccctgagaggctgacagcagagaaccgctactactgcgagtcgtgc
gcctccctgcaggacgccgagaaggtggtggagctgagccaggggccgcgctacctcatc
ctgaccctcctgcgcttctccttcgacctgcgcaccatgcggcgccgcaagatcctggac
gacgtctccatccccctgctgctccgcctgccgctggccgggggccacggccaggcctac
gacctctgcagcgttgtggtgcactctggagtgtcctcggagagcggtcactactactgc
tatgcccgcgagggcgctgcccgcccagccccttccgtgggcactgccgagaggcccgag
cccgagaaccagtggtatctgttcaacgacactcgggtgtccttctcctccttcgagtct
gtcagcaatgtcacctccttcttccccaaggacacggcttacgtgctcttttaccggcag
cggcccggggaggggcctgaggctgagccaggctctccccgagtccgggcggagcccacc
ctccacaaagacttgatggaagccatttccaaagacaacatcctttacctgcaggagcag
gagaaggaggcgcggagcagggcagcctacatctctacactcccctcatctccgcgttgg
gggaggggctttgacgaagacaaggatgaggatgaaggctctcccgggggctgcaaccct
gcaggtggcaatggtggtgacttccacagactggtcttctaa

DBGET integrated database retrieval system