KEGG   Equus caballus (horse): 100067782Help
Entry
100067782         CDS       T01058                                 

Gene name
AOX4
Definition
aldehyde oxidase-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
ecb  Equus caballus (horse)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100067782 (AOX4)
   00350 Tyrosine metabolism
    100067782 (AOX4)
   00380 Tryptophan metabolism
    100067782 (AOX4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100067782 (AOX4)
   00760 Nicotinate and nicotinamide metabolism
    100067782 (AOX4)
   00830 Retinol metabolism
    100067782 (AOX4)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100067782 (AOX4)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100067782 (AOX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 1335 aa AA seqDB search
MPSLPNSDELIFFVNGRKVIEKNADPEVNLLFYLRQVLHLPGTKYGCGGGGCGACTVMVS
RYYPKTKKIHHYPVTTCLVPICSLYGAAVTTVEGVGSIKTRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRTHPEPTPEQITEALGGNLCRCTGYRPIVESGKTFCVESTVCQVKGSG
RCYMEQDERPFVTRQEKMCTKLYDEDEFQPLDPSQKPIFPPELIRMAEDPNKRRLAFQGE
RTTWLTPVTLDDLLDLKTQFPKAPLVMGNTTVGPSMKFRDEFHPVFISPLWLPELHFVET
TDEGVTIGAGYSLAQLSDALRFIVSEQPKEKTRTHRALLRHLRTLAGAQIRNMATLGGHV
VSRPNYSDLNPILAAGNATINVISKEGERQIPLDGRFLERSPEANLKSEEIVLSVHIPYS
TQWHFVWGLRLAQRHENAFAIVNAGMSVRFEDSTDRIKALQMFYGSVGPTVVSAGQACQR
LIGRRWDDTALSDACRWVLDAVYVPPAAEGGLVEYRRTLIVSLLFKFYLKVRRGLNKMDP
QKFPDIPENFTSALEDFPIETPQGIQMFQCVDPKQPPQDPVGHPVMHQSAIKHATGEAVF
VDDMPPIAQELFLAVVTSTRAHAKIVSIDASKALALPGVVDVITAEDVPGNNNHKGEVLY
AQNEVICVGQIVCTVAADTYAHAREAAKKVKIAYEDIEPRIITIEQALEHNSFLFAEKKI
EKGNVEQGFKYVDQIIEGEVHVEGQEHFYMETQTILAIPKEEDKEMVLHLGTQYPTHVQE
FVAAALNVPRSRIACHMKRAGGAFGGKVTKPAVLGAVSAVAANKTGRPIRFVLERGDDML
ITAGRHPLLARYKVGFMNNGVIKAADVEYYINGGCTPDESELVIEFVVLKSENAYNIPNF
RCRGRPCKTNLPSNTAFRGFGFPQAAVVVEAYVSAVASQCNLPPEEVKEINMYKTISKTA
YKQTFNPEPLRRCWKECLEKSSFHARKLAAEEFNKKNYWKKRGLAVVPMKFTVGLPMTFY
NQAAALVHIYLDGSVLVIHGGCEMGQGLYTKMIQVASRELNIPQSYIHLSETSTVTVPNT
FFTAGSMGTDINGKAVQNACQILMARLQPVIRKNPKGSWEDWIAKAFQESISLSTTGYFK
GYQTNMDWKKEEGDAFPYYVYGASCSEVEVDCLTGAHKLLRTDIFMDSAFSINPALDIGQ
IEGAFVQGMGFYTIEELKYSPEGVLYSRGPDDYKIPTVSEIPEEFYVTLVRSQNPIAIYS
SKGLGEAGMFLGSSVLFAIYDAVTAARRERGLTKTFTLSSPATPELIRMTCVDQFTDMIP
RDDPSTFTPWSIRVS
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcccttcccaattctgacgagctgattttttttgtgaatggaagaaaggtcatc
gagaagaacgccgacccggaagtgaacctactgttctacctgaggcaagtcctccatctc
ccaggcacgaagtatggctgcggaggaggaggctgtggtgcctgcaccgtcatggtgtcg
agatactatcccaagaccaagaagatccaccattatccagttacaacgtgcctcgtgccc
atctgctctctgtatggggctgctgtcaccacggtggaaggtgtgggaagtatcaaaacc
aggattcatcccgtgcaggaaagacttgcgaagtgtcatggcacgcagtgtggcttctgc
agcccagggatggtgatgtccatctacacgctgctgaggacccacccggagccgaccccc
gagcagatcaccgaagctcttggaggtaatttgtgccgctgtactggataccgaccaatt
gtagaaagtgggaaaactttctgtgtggaatcaactgtttgccaagtgaaaggatcagga
agatgttacatggagcaagacgagaggcctttcgtgactagacaggaaaaaatgtgtacc
aaactgtatgatgaagacgaattccagcccttggatccgtcccagaaacctatatttcct
cctgaactgataagaatggcagaagacccaaacaagaggaggctggcgttccagggggaa
aggaccacctggctcacccccgtgaccctggacgaccttctggatttgaaaacccagttc
cccaaagcgcccctcgtcatggggaacaccacagtggggcccagcatgaaattcagagat
gaattccatccagttttcatatctccactctggcttccagaactgcattttgtggagacc
acagatgagggggtgacaataggtgcaggatacagcctggcccagttgagcgacgcctta
cgcttcattgtttcggagcaaccgaaggagaagacgaggacgcaccgcgctctcctgagg
cacctcaggacgctggccggggcccagattaggaacatggcgactttaggaggacatgtg
gtgagcagacctaattattctgacctaaatcccattttagccgcaggaaatgctaccatc
aatgtgatatctaaagaaggagagcggcagattcctttagatggccgtttccttgagaga
tcacctgaagccaaccttaaatcggaagagattgtgttatcggtccatattccctactcg
actcagtggcactttgtgtggggactgcggctggcccaacgtcatgagaacgcctttgcc
attgtcaacgctgggatgagcgtcaggtttgaggacagcacagacaggattaaggcgctt
caaatgttctacggaagtgttggccccaccgttgtctctgccgggcaggcctgccagcgg
ctcattgggaggcgatgggatgacacggcgctgagtgatgcctgccggtgggtcctggat
gcggtttacgtcccgcctgcggctgagggcggcctggtggagtacaggcggacgctcatc
gtcagcttactcttcaagttctacctcaaagtgaggcgaggactgaacaaaatggatccc
cagaagtttcctgatatccccgaaaacttcacgagcgctctagaagatttccccatagaa
accccgcaaggcattcagatgttccagtgtgtggatcccaaacaacctccacaagacccg
gttggccacccagtcatgcaccagtcagccattaaacatgccacaggggaagctgtgttt
gttgatgacatgccccccattgcccaagaactcttcctggctgtcgtcaccagcaccaga
gctcatgcaaagatcgtatcaattgatgcttcaaaagccttggcacttccaggtgtggtt
gacgtgataacagcagaggatgttccagggaacaataaccacaaaggagaggttctctat
gcacagaatgaggtaatttgcgtgggtcagatcgtctgcaccgtggctgctgacacctat
gctcatgcaagagaggccgctaaaaaagtgaagatcgcttatgaagacatagaaccaagg
atcatcacaatagagcaagccctggagcacaattcatttctttttgctgagaaaaaaatt
gagaaaggaaatgtagagcaaggctttaaatatgttgatcaaatcattgaaggtgaggtc
cacgtggaaggacaggaacatttttacatggagacacaaactatcctggctatcccaaaa
gaggaagataaagaaatggtgttacaccttggaacacagtatccaacccatgtgcaggaa
tttgtggctgcggcactaaacgtcccaaggagtaggatcgcctgccatatgaaaagagct
ggaggagcctttggggggaaagtgaccaagcctgctgtgctaggagctgtcagtgctgtg
gccgccaacaagactggccgcccaatccggtttgttttagagcgtggtgatgacatgctg
ataactgctggccgccacccactcctcgcaagatacaaagttggattcatgaacaatggt
gtgatcaaagctgctgacgttgaatattatatcaacggcggatgtactcctgatgagtct
gagctggtgatagagttcgttgtgctgaaatctgaaaatgcatataatattcctaatttt
cggtgccggggtaggccttgcaaaacaaacttgccatccaacactgcctttcgaggattc
ggcttcccccaggctgcagtggtagtggaagcttacgtatctgctgtggcatctcagtgt
aacttaccccctgaagaggttaaagaaataaacatgtataagacaattagcaaaacagcc
tataaacagacatttaatccagagcccttgcgaagatgctggaaagaatgtctggagaaa
tcctcatttcatgctaggaaactggctgctgaggaatttaacaaaaagaattactggaag
aagagggggcttgctgtggtccccatgaaattcaccgttgggcttcccatgaccttctac
aatcaggctgcagctctcgtccacatctatctcgatggctctgtcttggtgattcacggt
ggctgtgaaatgggacaaggcctttacaccaaaatgattcaggtggctagtcgcgaactg
aacatcccccagtcgtacatacacctgtcagaaaccagcacagtcaccgtgcccaacact
ttcttcacggcgggctccatggggacagacatcaacgggaaggctgtgcagaacgcctgc
caaattctcatggcccgtcttcagccagtcatcaggaagaaccccaagggaagctgggag
gactggattgcaaaagccttccaggaatccatcagtctctcgactactggatatttcaaa
ggctaccagacgaatatggactggaagaaggaggaaggggacgcttttccatattatgtc
tacggagcatcctgttctgaggttgaagtcgactgtctgacgggggctcataagctcctt
aggaccgacatcttcatggattctgctttcagcataaacccagccctggacattggacag
attgaaggagcgtttgttcaaggcatgggattctacaccatagaagagctgaaatactcc
cccgaaggtgtgctttattctcggggtccggatgactacaaaatccccactgtctctgag
ataccagaagagttctatgtcaccttggtgcgttcccaaaatcccatagccatctactca
tccaagggattgggcgaggctggaatgttcttgggatcctctgtgttgttcgccatatat
gatgcagtgactgctgcccgcagagagagggggctgaccaagaccttcaccctgagcagc
ccggcgactcctgagttgattaggatgacctgtgtggatcagtttactgacatgattccc
agagatgatccttcaacatttacaccttggtccatccgtgtgtcttaa

DBGET integrated database retrieval system