KEGG   Equus caballus (horse): 100069446Help
Entry
100069446         CDS       T01058                                 

Gene name
GTF3C4
Definition
(RefSeq) general transcription factor IIIC subunit 4
  KO
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100069446 (GTF3C4)
Transcription machinery [BR:ecb03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100069446 (GTF3C4)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100069446 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 826 aa AA seqDB search
MAGGEARPDLANRARRSARAHVGRARGPRVAAPPGPVAAPLPGPGRTVRTSEQSRGLRPQ
AVKLQYAVSGLEPLAWSEDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSC
LLKVGSKTEVAECKEKFATSKDPTVSQTFMLDRVFNPEGKALPPLRGFKYTSWSPMGCDA
NGRCLLAALTMDNRLTVQANLNRLQWVQLVDLTEIYGERLYETSYRLSKSEAPEGNLGDF
AEFQRRHSMQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVG
KESISSCNTIESGINSPSVLFWWEYEHNNRKMSGLIVGSAFGPVKILPVNLKAVKGYFTL
RQPVVLWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNS
HVTGLHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVR
THGIAVSPCGAYLAVITTEGMVNGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFKQ
VDLIDLIRWKILKDKHIPQFLQEALEKKIESSGATYFWRFKLFLLRILYQSMQKTPSEAL
CKPTHEDSKILLVDSPGVGNAEDEQQEEGTSSKQANKQGLQERSREADPEDTTDDSLTQA
GDAGGREPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFL
MSDEEYDDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLT
YQSCQSLIYRRCLLHDSIARHPVPEDPDWIKRLLQSPCPFCDSPVF
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggccggcggggaggctcgtccggacctggcgaaccgggcccgccgctccgctcgggcc
cacgtgggacgcgcacgaggaccccgcgtagctgccccaccgggtcctgtagccgcgccc
cttccgggtcccggacgcacggtccgcaccagtgagcagagccgagggctgcggccgcag
gccgtgaagctgcagtatgcggtgagcggcctggagccgttggcctggtctgaggaccac
cgcgtgtccgtgtcgacggcccgcagcatcgctgtgctggagctcatctgcgacgtgcac
aacccgggccaggacctggtcatccaccgcacgtcggtgcccgcccctctcaacagctgc
ctcctcaaagttggctcaaaaacagaagttgctgagtgtaaggagaaatttgccacctct
aaagaccccacggtcagtcagactttcatgttggatagagtgttcaaccctgaggggaag
gctttgccaccactgagaggattcaaatacactagctggtcgcccatgggttgtgatgct
aatggcaggtgccttttggcagcgctgaccatggacaatcgcctcaccgtccaggctaac
ctcaacagactgcagtgggtccagctggtcgatctgactgagatttacggggaacgtctt
tatgagaccagttacaggctctctaaaagtgaggccccggaaggaaatcttggggatttt
gctgagtttcagaggagacacagcatgcagactccagtcaggatggaatggtcaggcatc
tgtactactcagcaggtcaagcataacaatgagtgccgtgatgtgggcagtgtgctcctg
gcagtcctctttgaaaacggtaacattgctgtgtggcagtttcaactaccatttgtagga
aaggaatccatctcttcgtgcaacacaattgagtcaggaatcaactctcctagtgtttta
ttttggtgggaatatgagcacaataatcggaaaatgagcggccttattgtggggagtgct
tttggacctgtaaaaattcttcctgtcaatctcaaagcagttaaaggctatttcacttta
aggcaacctgttgtcttatggaaagaaatggaccagttgccagtgcacagtatcaaatgt
gtacctctttatcacccttaccagaagtgtagttgtagcttagtggtggctgcaagagga
tcctatgtgttttggtgtcttcttctgatctccaaagcgggtctgaatgttcacaattcc
cacgtcacaggccttcactccctgccgatcgtctccatgactgcagataagcagaacgga
acggtatatacttgttccagtgatgggaaagtgaggcagctgattcccattttcacagat
gttgcattaaagtttgaacaccagttgattaaactgtcagatgtgtttggctcggtgagg
acacacgggatagcagtgagcccctgtggtgcatatctggccgtcattacaactgagggc
atggtcaatggcctccatcccgtgaacaaaaactaccaggtccagtttgttactctcaaa
acctttgaagaggcagctgctcagctcctggaatcttctgttcaaaatctctttaagcag
gtggatttaatagacctaatacgctggaagattttaaaagataaacatatccctcaattt
ttacaagaagctttggaaaaaaagattgaaagcagtggggccacttatttttggcgtttt
aaacttttcctcctgaggattttgtatcagtcaatgcagaaaaccccttcagaagcccta
tgtaaacccacccatgaggactcaaagatcttactggttgactcgccaggggtgggcaat
gctgaggatgagcagcaagaagaaggcacgtcttccaaacaggcgaataaacagggcctt
caggagaggagcagagaggctgatccagaggacaccacggatgactcactcacccaggcc
ggagatgctggaggccgcgagccgatggaagagaaactcctggaaatccaagggaaaatt
gaagccgtggaaatgcacttgaccagagagcacatgaagcgagtcttaggagaagtgtac
ctgcacacctggatcacagaaaacactagcatccccaccaggggactctgtaacttttta
atgtctgatgaagagtatgatgacagaacagcacgggtgctgatcggacacatctccaag
aagatgaacaaacagacttttcctgagcactgtagtttgtgtaaagagatcttgccgttc
acagatcgcaaacaggcagtctgttccaatggccacatttggctccggtgctttttaacc
taccagtcctgccagagtctgatatacagaaggtgtttgctccatgacagcattgcccgc
catccagttccagaagatcctgactggattaagaggttactgcaaagcccctgccctttc
tgcgattctcctgtcttctaa

DBGET integrated database retrieval system