KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c5466Help
Entry
c5466             CDS       T00106                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ecc00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5206898..5208220
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMDTRALG
MAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLADKAPESTPTVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcgctgagtgatgaa
gaaattcgtttctttatcaacggcattcgcgacaacactatctccgaagggcagattgcc
gccctcgcgatgaccattttcttccacgatatgacaatgcctgagcgtgtctcgctgacc
atggcgatgcgagattcaggaaccgttctcgactggaaaagcctgcatctgaatggcccg
attgttgataaacactcgaccggcggtgtcggcgatgtgacttcgctgatgttggggccg
atggtcgctgcctgtggcggctatattccgatgatctccggtcgcggcctcggtcatact
ggcggtacgctcgacaaactggaatccatccctggcttcgacattttcccggatgacaac
cgtttccgcgaaattattaaagacgtcggtgtggcgattatcggccagaccagctcattg
gctccggcggataaacgtttctacgcgacccgcgatattaccgcaaccgtggattcaatc
ccgctgatcaccgcctctattctggcgaagaaactggcggaaggtctggacgcgctggtg
atggacgtgaaagtgggtagcggcgcgtttatgccgacctacgaactctctgaagccctt
gccgaagcgattgttggcgtggctaacggcgctggcgtgcgcaccaccgcgctgctcacc
gatatgaatcaggtactggcctccagtgcaggtaacgcggttgaagttcgtgaagcggtg
cagttcctgacgggtgaatatcgtaacccgcgtctgtttgatgtcacgatggcactgtgc
gtggagatgctgatctccggcaaactggcgaaagatgacgccgaagcgcgcgcgaaatta
caggcggtgctggacaacggtaaagcggcagaagtctttggtcgtatggtagcggcacaa
aaaggcccgaccgacttcgttgagaactacgcgaagtatctgccgacagcgatgctgacg
aaagcagtctatgctgataccgaagggtttgtcagtgaaatggatacccgcgcgctgggg
atggcagtggttgcaatgggcggcggacgccgtcaggcatctgacaccatcgattacagc
gtcggctttactgatatggcgcgtctgggcgaccaggtagacggtcagcgtccgctggca
gttatccacgcgaaagacgaaaacagctggcaggaagcggcgaaagcggtgaaagcggca
attaaacttgccgataaagcaccggaaagcacaccaactgtctatcgccgtatcagcgaa
taa

DBGET integrated database retrieval system