KEGG   Escherichia coli 55989 (EAEC): EC55989_5044Help
Entry
EC55989_5044      CDS       T00826                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00240  Pyrimidine metabolism
eck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EC55989_5044 (deoA)
Enzymes [BR:eck01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     EC55989_5044 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: CAV02182
UniProt: B7LEM8
Structure
PDB: 

Jmol
Position
5131355..5132677
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMDTRALG
MAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVIHAKDENSWQDAAKAVKAA
IKLADKAPESTPTVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcgctaagcgatgaa
gaaattcgtttctttatcaacggtattcgcgacaacactatctccgaagggcagattgcc
gccctcgcgatgaccattttcttccacgatatgacaatgcctgagcgtgtctcgctgacc
atggcgatgcgagattcaggaaccgttctcgactggaaaagcctgcatctgaatggcccg
attgttgataaacactccaccggcggcgtcggcgatgtgacttcgctgatgttggggccg
atggtcgcagcctgcggcggctatattccgatgatctccggtcgcggcctcggtcatact
ggcggtacgctcgacaaactggaatccatccctggcttcgacattttcccggatgacaac
cgtttccgcgaaattattaaagacgtcggcgtagcgattatcggccagaccagctcactg
gctccggcggataaacgtttctacgcgacccgtgatattaccgcaaccgtggactccatc
ccgctgatcactgcctcgatcctggcgaagaaactggcggaaggtctggatgcgctggtg
atggacgtgaaagtgggtagcggcgcgtttatgccgacctacgaactctctgaagccctt
gccgaagcgattgttggcgtggctaacggcgctggcgtgcgcaccaccgcgctgctcacc
gacatgaatcaggtactggcctccagtgcaggtaacgcggttgaagttcgtgaagcggtg
cagttcctgacgggtgaatatcgtaacccgcgtctgtttgatgtcacgatggcgctgtgc
gtggagatgctgatctccggcaaactggcgaaagatgacgccgaagcgcgcgcgaaattg
caggcggtgctggacaacggtaaagcggcagaagtctttggtcgtatggtagcggcacaa
aaaggcccgaccgacttcgttgagaactacgcgaagtatctgccgacagcgatgctgacg
aaagcagtctatgctgataccgaaggttttgtcagtgaaatggatacccgcgcgctgggg
atggcagtggttgcaatgggcggcggacgccgtcaggcatctgacaccatcgattacagc
gtcggctttactgatatggcgcgtctgggcgaccaggtagacggacagcgtccgctggct
gttatccacgcgaaagacgaaaacagctggcaggacgcggcgaaagcggtgaaagcggca
attaaacttgccgataaagcaccggaaagcacaccaactgtctatcgccgtatcagcgaa
taa

DBGET integrated database retrieval system