KEGG   Escherichia coli K-12 MG1655: b0014Help
Entry
b0014             CDS       T00007                                 

Gene name
dnaK
Definition
(RefSeq) chaperone Hsp70, with co-chaperone DnaJ
  KO
K04043  
molecular chaperone DnaK
Organism
eco  Escherichia coli K-12 MG1655
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    b0014 (dnaK)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     b0014 (dnaK)
Chaperones and folding catalysts [BR:eco03110]
 Heat shock proteins
  HSP70 / DNAK
   b0014 (dnaK)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    b0014 (dnaK)
  Matrix
   MMC/PAM proteins
    b0014 (dnaK)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0014 (dnaK)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   b0014 (dnaK)
  Exosomal proteins of breast cancer cells
   b0014 (dnaK)
  Exosomal proteins of colorectal cancer cells
   b0014 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
12163..14079
Genome map
AA seq 638 aa AA seqDB search
MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVT
NPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVL
KKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYG
LDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYL
VEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKV
TRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKE
PRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPT
KHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDA
DGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGD
HLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME
IAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaataattggtatcgacctgggtactaccaactcttgtgtagcgattatggat
ggcaccactcctcgcgtgctggagaacgccgaaggcgatcgcaccacgccttctatcatt
gcctatacccaggatggtgaaactctagttggtcagccggctaaacgtcaggcagtgacg
aacccgcaaaacactctgtttgcgattaaacgcctgattggtcgccgcttccaggacgaa
gaagtacagcgtgatgtttccatcatgccgttcaaaattattgctgctgataacggcgac
gcatgggtcgaagttaaaggccagaaaatggcaccgccgcagatttctgctgaagtgctg
aaaaaaatgaagaaaaccgctgaagattacctgggtgaaccggtaactgaagctgttatc
accgtaccggcatactttaacgatgctcagcgtcaggcaaccaaagacgcaggccgtatc
gctggtctggaagtaaaacgtatcatcaacgaaccgaccgcagctgcgctggcttacggt
ctggacaaaggcactggcaaccgtactatcgcggtttatgacctgggtggtggtactttc
gatatttctattatcgaaatcgacgaagttgacggcgaaaaaaccttcgaagttctggca
accaacggtgatacccacctggggggtgaagacttcgacagccgtctgatcaactatctg
gttgaagaattcaagaaagatcagggcattgacctgcgcaacgatccgctggcaatgcag
cgcctgaaagaagcggcagaaaaagcgaaaatcgaactgtcttccgctcagcagaccgac
gttaacctgccatacatcactgcagacgcgaccggtccgaaacacatgaacatcaaagtg
actcgtgcgaaactggaaagcctggttgaagatctggtaaaccgttccattgagccgctg
aaagttgcactgcaggacgctggcctgtccgtatctgatatcgacgacgttatcctcgtt
ggtggtcagactcgtatgccaatggttcagaagaaagttgctgagttctttggtaaagag
ccgcgtaaagacgttaacccggacgaagctgtagcaatcggtgctgctgttcagggtggt
gttctgactggtgacgtaaaagacgtactgctgctggacgttaccccgctgtctctgggt
atcgaaaccatgggcggtgtgatgacgacgctgatcgcgaaaaacaccactatcccgacc
aagcacagccaggtgttctctaccgctgaagacaaccagtctgcggtaaccatccatgtg
ctgcagggtgaacgtaaacgtgcggctgataacaaatctctgggtcagttcaacctagat
ggtatcaacccggcaccgcgcggcatgccgcagatcgaagttaccttcgatatcgatgct
gacggtatcctgcacgtttccgcgaaagataaaaacagcggtaaagagcagaagatcacc
atcaaggcttcttctggtctgaacgaagatgaaatccagaaaatggtacgcgacgcagaa
gctaacgccgaagctgaccgtaagtttgaagagctggtacagactcgcaaccagggcgac
catctgctgcacagcacccgtaagcaggttgaagaagcaggcgacaaactgccggctgac
gacaaaactgctatcgagtctgcgctgactgcactggaaactgctctgaaaggtgaagac
aaagccgctatcgaagcgaaaatgcaggaactggcacaggtttcccagaaactgatggaa
atcgcccagcagcaacatgcccagcagcagactgccggtgctgatgcttctgcaaacaac
gcgaaagatgacgatgttgtcgacgctgaatttgaagaagtcaaagacaaaaaataa

DBGET integrated database retrieval system