KEGG   Escherichia coli K-12 MG1655: b0131Help
Entry
b0131             CDS       T00007                                 

Gene name
panD
Definition
(RefSeq) aspartate 1-decarboxylase (EC:4.1.1.11)
  KO
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    b0131 (panD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b0131 (panD)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     b0131 (panD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(146314..146694)
Genome map
AA seq 126 aa AA seqDB search
MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI
AAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKA
IPVQVA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcacgatgctgcagggcaaactccaccgcgtgaaagtgactcatgcggacctg
cactatgaaggttcttgcgccattgaccaggattttcttgacgcagccggtattctcgaa
aacgaagccattgatatctggaatgtcaccaacggcaagcgtttctccacttatgccatc
gcggcagaacgcggttcgagaattatttctgttaacggtgcggcggcccactgcgccagt
gtcggcgatattgtcatcatcgccagcttcgttaccatgccagatgaagaagctcgcacc
tggcgacccaacgtcgcctattttgaaggcgacaatgaaatgaaacgtaccgcgaaagcg
attccggtacaggttgcttga

DBGET integrated database retrieval system