KEGG   Escherichia coli K-12 MG1655: b0137Help
Entry
b0137             CDS       T00007                                 

Gene name
yadL
Definition
(RefSeq) putative fimbrial-like adhesin protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(151626..152231)
Genome map
AA seq 201 aa AA seqDB search
MMTFKNLRYGLSSSVVLAASLFSVLSYAATDSIGLTVITTVEMGTCTATLVNDSDQDISV
VDFGDVYISEINAKTKVKTFKLKFKDCAGIPNKKAQIKLTKRATCEGTANDGAGFANGST
AADKASAVAVEVWSTVTPATGSATQFSCVTPASQEVTISTAANAVVYYPMSARLVVEKNK
TVNNVTAGKFSAPATFTVTYN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgacatttaaaaatttacgttatggattatccagcagtgtcgttttggctgcctca
ttgttcagcgtactctcttatgcggcaacagacagtattggactgaccgttattactact
gtagaaatgggtacttgtaccgctacattagtaaatgactctgatcaggacatttctgtt
gttgattttggtgatgtatatatttctgaaatcaatgccaagaccaaagtaaaaacattc
aaactcaaattcaaagactgtgcgggtatccccaataaaaaagcgcaaataaaattaacc
aagcgagccacatgcgagggaactgctaatgacggtgcggggtttgcaaatggttccaca
gccgcagataaagcaagtgctgtcgccgttgaagtctggagcactgtaactccggcaaca
gggagtgcaacacaatttagctgtgtaacaccagcatcacaagaggtaacaatctccact
gcagccaatgcggtcgtttattatccgatgagtgcacgcctggtcgtggaaaaaaataaa
accgtaaacaatgtcactgcgggtaagttttctgcaccagccacatttacagtaacctat
aactaa

DBGET integrated database retrieval system