KEGG   Escherichia coli K-12 MG1655: b0174Help
Entry
b0174             CDS       T00007                                 

Gene name
ispU
Definition
(RefSeq) undecaprenyl pyrophosphate synthase
  KO
K00806  
undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    b0174 (ispU)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     b0174 (ispU)
Prenyltransferases [BR:eco01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   b0174 (ispU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
194903..195664
Genome map
AA seq 253 aa AA seqDB search
MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANN
GIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRL
QERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQH
VCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE
RRFGGTEPGDETA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgatgttgtctgctactcaaccacttagcgaaaaattgccagcgcatggctgccgtcat
gttgcgatcattatggacggcaatggccgctgggcaaaaaagcaagggaagattcgtgcc
tttgggcataaagccggggcaaaatccgtccgccgggctgtctcttttgcggccaacaac
ggtattgaggcgttaacgctgtatgcctttagtagtgaaaactggaaccgaccagcgcag
gaagtcagtgcgttaatggaactgtttgtgtgggcgctcgatagcgaagtaaaaagtctg
caccgacataacgtgcgtctgcgtattattggcgataccagtcgctttaactcgcgtttg
caagaacgtattcgtaaatctgaagcgctaacagccgggaataccggtctgacgctgaat
attgcggcgaactacggtggacgttgggatatagtccagggagtcaggcaactggctgaa
aaggtgcagcaaggaaacctgcaaccagatcagatagatgaagagatgctaaaccagcat
gtctgtatgcatgaactggcccctgtagatttagtaattaggactgggggggagcatcgc
attagtaactttttgctttggcaaattgcctatgccgaactttactttacagatgttctc
tggcccgatttcgatgaacaagactttgaaggggcgttaaatgcctttgctaatcgagag
cgtcgtttcggcggcaccgagcccggtgatgaaacagcctga

DBGET integrated database retrieval system