KEGG   Escherichia coli K-12 MG1655: b0341Help
Entry
b0341             CDS       T00007                                 

Gene name
cynX
Definition
(RefSeq) putative cyanate transporter
  KO
K03449  
MFS transporter, CP family, cyanate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Cyanate porter (CP) family [TC:2.A.1.17]
    b0341 (cynX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
359992..361146
Genome map
AA seq 384 aa AA seqDB search
MLLVLVLIGLNMRPLLTSVGPLLPQLRQASGMSFSVAALLTALPVVTMGGLALAGSWLHQ
HVSERRSVAISLLLIAVGALMRELYPQSALLLSSALLGGVGIGIIQAVMPSVIKRRFQQR
TPLVMGLWSAALMGGGGLGAAITPWLVQHSETWYQTLAWWALPAVVALFAWWWQSAREVA
SSHKTTTTPVRVVFTPRAWTLGVYFGLINGGYASLIAWLPAFYIEIGASAQYSGSLLALM
TLGQAAGALLMPAMARHQDRRKLLMLALVLQLVGFCGFIWLPMQLPVLWAMVCGLGLGGA
FPLCLLLALDHSVQPAIAGKLVAFMQGIGFIIAGLAPWFSGVLRSISGNYLMDWAFHALC
VVGLMIITLRFAPVRFPQLWVKEA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggtactggtgctgattggtcttaatatgcgaccactgctcacctccgtcggg
ccactgctaccgcaattgcgccaggcgagcggaatgagctttagcgtggctgccctgttg
accgctctgccggtggttaccatgggcgggctggcgctggccggaagctggcttcatcag
catgtcagcgaacgtcgcagtgtcgccatcagtctgttgctgattgccgtcggtgcattg
atgcgtgagctttacccgcaaagtgcgctgctgcttagcagcgcactgcttggtggggtg
gggatcggcatcattcaggcggtgatgccttcggtgattaaacggcggtttcagcagcgc
acgccactggtgatggggctgtggtccgcggctctgatgggcggcggtgggcttggtgcc
gccataacgccctggttagttcaacatagcgaaacctggtatcaaacactcgcctggtgg
gcgctgcctgccgttgttgcgctctttgcctggtggtggcaaagcgcccgcgaggtcgcc
tcttcccacaagacaacaaccactccggttcgcgtggtattcactccccgcgcgtggacg
ctgggtgtttacttcggtctgattaacggcggttacgccagcctgattgcctggttaccc
gctttctatattgagattggtgccagcgcgcagtacagcggttccttactggcattgatg
acgcttgggcaagccgcaggagctttgctgatgcctgctatggctcgccatcaggatcgg
cgcaaactgttaatgctggcgctggtgttacaactggtggggttctgcggctttatctgg
ctgccgatgcaattgccggtattgtgggcgatggtgtgtgggttaggtctgggcggcgcg
tttccgctctgtttgctgctggcgctcgatcactctgtgcaaccggctattgctggcaag
ctggtggcgtttatgcagggaatcggttttatcatcgccgggcttgccccgtggttttct
ggcgtgctgcgtagtatcagcggcaattacctgatggactgggcatttcatgcgctgtgc
gtcgttgggctgatgatcataaccctgcgttttgcaccagtacgttttccgcagctgtgg
gtcaaagaggcatga

DBGET integrated database retrieval system