KEGG   Escherichia coli K-12 MG1655: b0635Help
Entry
b0635             CDS       T00007                                 

Gene name
mrdA
Definition
(RefSeq) transpeptidase involved in peptidoglycan synthesis (penicillin-binding protein 2)
  KO
K05515  
penicillin-binding protein 2
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Peptidoglycan biosynthesis
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    b0635 (mrdA)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    b0635 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(666316..668217)
Genome map
AA seq 633 aa AA seqDB search
MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIVRFTDYQTRSNENRIK
LVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDALRSVVDLTDDDIAAFR
KERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKRRYYPYGSALTHVIGYVS
KINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQTGYEEVEVNNRGRVIRQLK
EVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTGGVLALVSTPSYDPNLFVDG
ISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSALSAGVITRNTTLFDPGWWQL
PGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGID
LAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYWTATPIQMSKALMILINDGIVKV
PHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKDGMYGVANRPNGTAHKYFASAPYK
IAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTAFAPYNNPQVAVAMILENGGAGPAV
GTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacagaactcttttcgcgactatacggcagagtccgcgctgtttgtgcgccgg
gcgctggtcgcctttttggggattttgctgctgaccggcgtgcttatcgccaacctgtat
aatctgcaaattgttcgctttaccgactaccagacccgctctaatgaaaaccgcattaag
ctggtgcctatcgcgcccagccgcggcattatctacgatcgtaacggtatccctctggcc
ctcaaccgcactatctaccagatagaaatgatgccggagaaagtcgataacgtgcagcaa
acgctggacgctttgcgcagcgtggtagatctgaccgatgacgatattgctgcattccga
aaagagcgcgcacgttcacaccgtttcacctctattccggtgaaaactaacctgaccgaa
gtacaagtagctcgctttgccgtcaatcagtaccgttttccgggtgtcgaagttaaaggc
tataaacgtcgttactatccttacggttcggcgttgacccacgtcatcggctatgtgtcg
aaaatcaacgataaagacgtcgaacgcctgaataatgacggcaaactggccaactatgcg
gcaacgcatgatatcggtaagctgggcattgagcgttactatgaagatgtgctgcacggt
cagaccggttatgaagaggttgaagttaacaaccgtgggcgtgttattcgccagttaaaa
gaagtaccaccgcaagccggacacgatatttacctgacgctggatctcaaactccagcaa
tatattgaaacgctgctggcgggtagccgcgcagctgtggtagtcaccgatccgcgtaca
ggtggggtgctggcgctggtttccacgcctagttatgacccaaacttgtttgttgacggt
atctccagcaaagattattccgccttgttgaacgatccgaatacaccgctggtgaaccgc
gccacacagggggtttatcctcccgcgtctacagttaaaccctatgtggcggtttcggca
ttgagcgccggggtgatcacgcgcaatacgacgctgtttgacccaggctggtggcaactg
ccaggttcggaaaaacgttatcgtgactggaaaaaatggggccacgggcgtctgaatgtc
acaagatcgctggaagaatctgcggataccttcttctatcaggtggcctacgatatgggg
atcgatcgcctctccgaatggatgggtaaattcggttatggtcattacaccggtatcgac
ctggcggaagaacgttccggcaacatgcctacccgcgaatggaaacagaaacgctttaaa
aaaccgtggtatcagggtgacaccattccggttggtatcggtcagggttactggacagcg
accccaatccagatgagtaaggcactgatgatcctgattaatgacggtatcgtgaaggtt
cctcatttgctgatgagcaccgccgaagacggcaaacaggtgccatgggtacagccgcat
gaaccgcccgtcggcgatattcattccggttactgggagctggcgaaagacggtatgtac
ggtgttgctaaccgccctaacggtacggcgcataaatactttgctagcgcaccgtacaaa
attgcggcgaaatccggtaccgctcaggtcttcggtctgaaagcgaacgaaacctataat
gcgcacaaaattgccgagcgtttacgtgaccacaaactgatgaccgcctttgcgccatac
aacaatccgcaagtggctgtcgccatgattctggagaacggtggtgcgggtccggcggtt
ggtacactgatgcgccagatcctcgaccacattatgctgggtgataacaacaccgatctg
cctgcggaaaatccagcggttgccgcagcggaggaccattaa

DBGET integrated database retrieval system