KEGG   Escherichia coli K-12 MG1655: b0729Help
Entry
b0729             CDS       T00007                                 

Gene name
sucD
Definition
(RefSeq) succinyl-CoA synthetase, NAD(P)-binding, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00020  Citrate cycle (TCA cycle)
eco00640  Propanoate metabolism
eco00660  C5-Branched dibasic acid metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
Module
eco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    b0729 (sucD)
   00640 Propanoate metabolism
    b0729 (sucD)
   00660 C5-Branched dibasic acid metabolism
    b0729 (sucD)
Enzymes [BR:eco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     b0729 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 945314
NCBI-ProteinID: NP_415257
Pasteur: sucD
RegulonDB: ECK120000971
ECOCYC: EG10982
ASAP: ABE-0002485
UniProt: P0AGE9
Structure
PDB: 

Jmol
Position
764180..765049
Genome map
AA seq 289 aa AA seqDB search
MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREA
VAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMI
GPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGG
DPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtccattttaatcgataaaaacaccaaggttatctgccagggctttaccggtagccag
gggactttccactcagaacaggccattgcatacggcactaaaatggttggcggcgtaacc
ccaggtaaaggcggcaccacccacctcggcctgccggtgttcaacaccgtgcgtgaagcc
gttgctgccactggcgctaccgcttctgttatctacgtaccagcaccgttctgcaaagac
tccattctggaagccatcgacgcaggcatcaaactgattatcaccatcactgaaggcatc
ccgacgctggatatgctgaccgtgaaagtgaagctggatgaagcaggcgttcgtatgatc
ggcccgaactgcccaggcgttatcactccgggtgaatgcaaaatcggtatccagcctggt
cacattcacaaaccgggtaaagtgggtatcgtttcccgttccggtacactgacctatgaa
gcggttaaacagaccacggattacggtttcggtcagtcgacctgtgtcggtatcggcggt
gacccgatcccgggctctaactttatcgacattctcgaaatgttcgaaaaagatccgcag
accgaagcgatcgtgatgatcggtgagatcggcggtagcgctgaagaagaagcagctgcg
tacatcaaagagcacgttaccaagccagttgtgggttacatcgctggtgtgactgcgccg
aaaggcaaacgtatgggccacgcgggtgccatcattgccggtgggaaagggactgcggat
gagaaattcgctgctctggaagccgcaggcgtgaaaaccgttcgcagcctggcggatatc
ggtgaagcactgaaaactgttctgaaataa

DBGET integrated database retrieval system