KEGG   Escherichia coli K-12 MG1655: b0729Help
Entry
b0729             CDS       T00007                                 

Gene name
sucD
Definition
(RefSeq) succinyl-CoA synthetase, NAD(P)-binding, alpha subunit (EC:6.2.1.5)
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b0729 (sucD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    b0729 (sucD)
   00640 Propanoate metabolism
    b0729 (sucD)
   00660 C5-Branched dibasic acid metabolism
    b0729 (sucD)
Enzymes [BR:eco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     b0729 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
764180..765049
Genome map
AA seq 289 aa AA seqDB search
MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREA
VAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMI
GPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGG
DPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtccattttaatcgataaaaacaccaaggttatctgccagggctttaccggtagccag
gggactttccactcagaacaggccattgcatacggcactaaaatggttggcggcgtaacc
ccaggtaaaggcggcaccacccacctcggcctgccggtgttcaacaccgtgcgtgaagcc
gttgctgccactggcgctaccgcttctgttatctacgtaccagcaccgttctgcaaagac
tccattctggaagccatcgacgcaggcatcaaactgattatcaccatcactgaaggcatc
ccgacgctggatatgctgaccgtgaaagtgaagctggatgaagcaggcgttcgtatgatc
ggcccgaactgcccaggcgttatcactccgggtgaatgcaaaatcggtatccagcctggt
cacattcacaaaccgggtaaagtgggtatcgtttcccgttccggtacactgacctatgaa
gcggttaaacagaccacggattacggtttcggtcagtcgacctgtgtcggtatcggcggt
gacccgatcccgggctctaactttatcgacattctcgaaatgttcgaaaaagatccgcag
accgaagcgatcgtgatgatcggtgagatcggcggtagcgctgaagaagaagcagctgcg
tacatcaaagagcacgttaccaagccagttgtgggttacatcgctggtgtgactgcgccg
aaaggcaaacgtatgggccacgcgggtgccatcattgccggtgggaaagggactgcggat
gagaaattcgctgctctggaagccgcaggcgtgaaaaccgttcgcagcctggcggatatc
ggtgaagcactgaaaactgttctgaaataa

DBGET integrated database retrieval system