KEGG   Escherichia coli K-12 MG1655: b0928Help
Entry
b0928             CDS       T00007                                 

Gene name
aspC
Definition
(RefSeq) aspartate aminotransferase, PLP-dependent (EC:2.6.1.1)
  KO
K00813  
aspartate aminotransferase [EC:2.6.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    b0928 (aspC)
   01230 Biosynthesis of amino acids
    b0928 (aspC)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b0928 (aspC)
   00270 Cysteine and methionine metabolism
    b0928 (aspC)
   00220 Arginine biosynthesis
    b0928 (aspC)
   00330 Arginine and proline metabolism
    b0928 (aspC)
   00350 Tyrosine metabolism
    b0928 (aspC)
   00360 Phenylalanine metabolism
    b0928 (aspC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    b0928 (aspC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    b0928 (aspC)
Enzymes [BR:eco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     b0928 (aspC)
Amino acid related enzymes [BR:eco01007]
 Aminotransferase (transaminase)
  Class I
   b0928 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(984519..985709)
Genome map
AA seq 396 aa AA seqDB search
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE
TTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSV
KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGC
CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV
ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR
LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaacattaccgccgctcctgccgacccgattctgggcctggccgatctgttt
cgtgccgatgaacgtcccggcaaaattaacctcgggattggtgtctataaagatgagacg
ggcaaaaccccggtactgaccagcgtgaaaaaggctgaacagtatctgctcgaaaatgaa
accaccaaaaattacctcggcattgacggcatccctgaatttggtcgctgcactcaggaa
ctgctgtttggtaaaggtagcgccctgatcaatgacaaacgtgctcgcacggcacagact
ccggggggcactggcgcactacgcgtggctgccgatttcctggcaaaaaataccagcgtt
aagcgtgtgtgggtgagcaacccaagctggccgaaccataagagcgtctttaactctgca
ggtctggaagttcgtgaatacgcttattatgatgcggaaaatcacactcttgacttcgat
gcactgattaacagcctgaatgaagctcaggctggcgacgtagtgctgttccatggctgc
tgccataacccaaccggtatcgaccctacgctggaacaatggcaaacactggcacaactc
tccgttgagaaaggctggttaccgctgtttgacttcgcttaccagggttttgcccgtggt
ctggaagaagatgctgaaggactgcgcgctttcgcggctatgcataaagagctgattgtt
gccagttcctactctaaaaactttggcctgtacaacgagcgtgttggcgcttgtactctg
gttgctgccgacagtgaaaccgttgatcgcgcattcagccaaatgaaagcggcgattcgc
gctaactactctaacccaccagcacacggcgcttctgttgttgccaccatcctgagcaac
gatgcgttacgtgcgatttgggaacaagagctgactgatatgcgccagcgtattcagcgt
atgcgtcagttgttcgtcaatacgctgcaggaaaaaggcgcaaaccgcgacttcagcttt
atcatcaaacagaacggcatgttctccttcagtggcctgacaaaagaacaagtgctgcgt
ctgcgcgaagagtttggcgtatatgcggttgcttctggtcgcgtaaatgtggccgggatg
acaccagataacatggctccgctgtgcgaagcgattgtggcagtgctgtaa

DBGET integrated database retrieval system