KEGG   Escherichia coli K-12 MG1655: b1478Help
Entry
b1478             CDS       T00007                                 

Gene name
adhP
Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:eco01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eco00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:eco00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:eco00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:eco00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:eco00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1552828..1553838)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTYKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSHTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacgtataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagtgggtccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggagtcaccacctacaaagccgttaagctgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggcgcagatttagcgattaactcacacaccgaagacgccgccaaa
attgtgcaggagaaaactggtggcgctcacgctgcggtggtaacagcggtagctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtcta
ccgccggagtctatgagcctggatatcccacgtcttgtgctggatggtattgaagtggtc
ggttcgctggtcggcacgcgccaggatttaactgaagccttccagtttgccgccgaaggt
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttactgag
atggaagaaggcaaaatccgtggccgcatggtgattgatttccgtcactaa

DBGET integrated database retrieval system