KEGG   Escherichia coli K-12 MG1655: b1529Help
Entry
b1529             CDS       T00007                                 

Gene name
marC
Definition
(RefSeq) UPF0056 family inner membrane protein
  KO
K05595  
multiple antibiotic resistance protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1529 (marC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1618243..1618908)
Genome map
AA seq 221 aa AA seqDB search
MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSLMASVYVFAIMMVAYY
AGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSEELEDEPSANIA
FVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGA
IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTYH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttagatttgtttaaagcaattggcctggggctggtggtgttgctgccgttagctaac
ccattaacaactgtcgcgttatttcttggcctggcaggcaacatgaacagtgccgaacgt
aatcgtcagtcgttgatggcctcggtgtacgtatttgccatcatgatggtggcgtattac
gccgggcaactggtgatggatacatttggcatttcgattcccggtctgcgaattgcaggc
ggcttaatcgtcgcgtttatcggttttcggatgctctttccgcaacagaaagcgattgat
tcaccggaggcgaaaagcaagtcggaagagctggaagatgaacccagtgccaatattgcc
tttgtgccgctggcaatgccaagtactgccggtccgggaaccatagcgatgattattagc
tcggcgtccacagtgcgtcagagttcaaccttcgctgattgggtactgatggttgcgccg
ccgctgatctttttcctggtggcggttattttgtggggaagcctacgcagctccggcgca
attatgcggctggtgggcaagggtggcattgaagcgatctcccgtctgatgggattcctg
ctggtatgtatgggtgtgcagtttattattaacggcatcctggaaatcattaaaacgtac
cattaa

DBGET integrated database retrieval system