KEGG   Escherichia coli K-12 MG1655: b1756Help
Entry
b1756             CDS       T00007                                 

Gene name
ynjD
Definition
(RefSeq) putative ABC transporter ATPase
  KO
K05779  
putative thiamine transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Module
Putative thiamine transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative thiamine transporter [MD:M00192] [OT]
    b1756 (ynjD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1838747..1839400
Genome map
AA seq 217 aa AA seqDB search
MLCVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGE
LWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALER
SGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEV
RALAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKLR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcgtgaaaaatgtttcgctacgtttaccagaaagccgcttgctgacaaacgtt
aactttacggtggataaaggtgacattgtcacgttaatggggccgtctggctgtggaaaa
tccactctgttttcatggatgattggtgcactggccgaacagttttcttgtacaggtgag
ctatggctcaatgagcaacggattgacatcctacccaccgcacagcgtcagattggcatt
ctttttcaggatgcactgttatttgaccagttcagtgtcgggcaaaatttactgctggcg
ctaccggcgacacttaaagggaatgcccgacgtaatgccgtgaatgatgcacttgagcgt
tcaggccttgagggagctttccatcaggatcctgccactttgtctggcggtcagcgagcg
cgcgttgctctactacgcgcccttctcgcccaaccaaaagcgttactcctggatgagcca
ttcagccgtcttgatgtggctctgcgcgataattttcgccagtgggtgttcagcgaagtt
cgcgccctggcgatccccgtcgttcaggtaacgcacgatctccaggatgttcctgctgat
agttctgttctggatatggcgcagtggtcagaaaattacaacaaactgcgataa

DBGET integrated database retrieval system