KEGG   Escherichia coli K-12 MG1655: b2143Help
Entry
b2143             CDS       T00007                                 

Gene name
cdd
Definition
(RefSeq) cytidine/deoxycytidine deaminase (EC:3.5.4.5)
  KO
K01489  
cytidine deaminase [EC:3.5.4.5]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    b2143 (cdd)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     b2143 (cdd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
2231844..2232728
Genome map
AA seq 294 aa AA seqDB search
MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDALAFALLPLA
AACARTPLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALA
AITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPKDLEIKTLLMDEQ
DHGYALTGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSYAENAAFNPTLPPL
QGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHSIDRVLLA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcatccacgttttcaaaccgcttttgcccaacttgcggataacttgcaatctgcactg
gaacctattctggcagacaagtacttccccgctttgttgaccggggagcaagtctcatcg
ctgaagagcgcaacggggctggacgaagacgcgctggcattcgcactacttccgctggcg
gcggcctgtgcgcgtacgccattgtcgaattttaatgttggcgcaattgcgcgcggtgtg
agcggaacctggtatttcggtgccaatatggaatttattggtgcgacaatgcagcaaacc
gttcatgccgaacaaagcgcgatcagccacgcctggttgagtggtgaaaaagcgcttgca
gccatcaccgttaactacacgccttgtggtcactgccgtcagtttatgaatgaactgaac
agcggtctggatctgcgtattcatctgccgggccgcgaggcacacgcgctgcgtgactat
ctgccagatgcctttgggccgaaagatctggagattaaaacgctgctgatggacgaacag
gatcacggctatgcgctgacgggtgatgcgctttctcaggcagcgattgcggcggcaaac
cgttcgcacatgccttacagtaagtcgccaagcggtgtcgcgctggaatgtaaagacggt
cgtattttcagtggcagctacgctgaaaacgccgcattcaacccgactctgccaccgttg
cagggagcgttaattctgttgaatctcaagggttatgattacccggatatccagcgcgcg
gttctggcagaaaaagccgatgcgccgttgattcagtgggatgccacctccgcaacgctg
aaagctctcggctgtcacagtatcgaccgagtgcttctcgcttaa

DBGET integrated database retrieval system