KEGG   Escherichia coli K-12 MG1655: b2659Help
Entry
b2659             CDS       T00007                                 

Gene name
csiD
Definition
(RefSeq) carbon starvation protein
  KO
K15737  
protein CsiD
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
2788985..2789962
Genome map
AA seq 325 aa AA seqDB search
MNALTAVQNNAVDSGQDYSGFTLTPSAQSPRLLELTFTEQTTKQFLEQVAEWPVQALEYK
SFLRFRVAKILDDLCANQLQPLLLKTLLNRAEGALLINAVGVDDVKQADEMVKLATAVAH
LIGRSNFDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELHNDGTYVEEITDYVLMMKIDE
QNMQGGNSLLLHLDDWEHLDNYFRHPLARRPMRFAAPPSKNVSKDVFHPVFDVDQQGRPV
MRYIDQFVQPKDFEEGVWLSELSDAIETSKGILSVPVPVGKFLLINNLFWLHGRDRFTPH
PDLRRELMRQRGYFAYASNHYQTHQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcactgaccgccgtacaaaataacgctgtcgattcaggccaggactatagcgga
ttcaccctcaccccgtcggcgcaatccccgcgtctgctggaactcaccttcaccgaacag
acgaccaaacagtttcttgagcaggttgccgagtggcccgtgcaggcgctggagtacaaa
tcgtttctgcgttttcgggtagccaaaattcttgacgatctatgtgcgaaccagctgcaa
ccattgctgttgaagacgttgctaaaccgcgctgaaggtgcgttgttgatcaatgcggtg
ggtgtcgatgatgtgaagcaagcggatgagatggtgaagctggcgacggcggtggcgcat
ctgattggccgttccaatttcgatgcgatgagcggtcagtattacgcgcgttttgtagtg
aaaaatgtcgataactcagacagctatctgcgccagccgcaccgcgtgatggagctacac
aacgacggcacgtatgtcgaagagataaccgattacgtgctgatgatgaaaatcgacgag
caaaacatgcagggcggaaattcgctgctgctgcatctcgatgactgggaacatctcgac
aactatttccgccacccgctggcgcgtcgcccgatgcgctttgccgcgccgccgagtaaa
aacgtcagcaaagatgtttttcatccggtgttcgacgtcgatcaacagggtcgcccggtg
atgcgctatatcgaccagttcgtccagccgaaagacttcgaagaaggcgtgtggttgagc
gagctttccgacgccattgaaaccagcaaaggcattctttctgtgcccgttcccgttggc
aaattcctgttgattaacaacctgttctggctgcacggtcgcgaccgctttactccgcac
ccggatctgcgccgtgaactgatgcgccagcgtggctatttcgcttacgcctctaaccac
taccagacgcatcagtaa

DBGET integrated database retrieval system