KEGG   Escherichia coli K-12 MG1655: b2687Help
Entry
b2687             CDS       T00007                                 

Gene name
luxS
Definition
(RefSeq) S-ribosylhomocysteine lyase
  KO
K07173  
S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Quorum sensing
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    b2687 (luxS)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    b2687 (luxS)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    b2687 (luxS)
Enzymes [BR:eco01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     b2687 (luxS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2814218..2814733)
Genome map
AA seq 171 aa AA seqDB search
MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLF
AGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQI
PELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgttagatagcttcacagtcgatcatacccggatggaagcgcctgcagttcgg
gtggcgaaaacaatgaacaccccgcatggcgacgcaatcaccgtgttcgatctgcgcttc
tgcgtgccgaacaaagaagtgatgccagaaagagggatccataccctggagcacctgttt
gctggttttatgcgtaaccatcttaacggtaatggtgtagagattatcgatatctcgcca
atgggctgccgcaccggtttttatatgagtctgattggtacgccagatgagcagcgtgtt
gctgatgcctggaaagcggcaatggaagacgtgctgaaagtgcaggatcagaatcagatc
ccggaactgaacgtctaccagtgtggcacttaccagatgcactcgttgcaggaagcgcag
gatattgcgcgtagcattctggaacgtgacgtacgcatcaacagcaacgaagaactggca
ctgccgaaagagaagttgcaggaactgcacatctag

DBGET integrated database retrieval system