KEGG   Escherichia coli K-12 MG1655: b2777Help
Entry
b2777             CDS       T00007                                 

Gene name
queE
Definition
(RefSeq) 7-carboxy-7-deazaguanine synthase; queosine biosynthesis
  KO
K10026  
7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    b2777 (queE)
Enzymes [BR:eco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     b2777 (queE)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    b2777 (queE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2904747..2905418)
Genome map
AA seq 223 aa AA seqDB search
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAK
TKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETS
GTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDIEALDELLATLTD
DKPRVIALQPISQKDDATRLCIETCIARNWRLSMQTHKYLNIA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacccgattaacgagatgttccagaccctgcaaggtgagggttactttaccggc
gttcccgccatttttattcgtttacagggatgcccggttggctgtgcctggtgcgacacc
aaacacacctgggaaaagcttgaggatcgggaagtctcccttttcagcattctggcgaag
accaaagagagtgataagtggggggctgcgagcagtgaagatttgctggctgtcattggt
cgccagggatacaccgcgcggcatgtggtgattacgggtggtgagccttgcattcatgat
ttgctgccactgactgatctgctcgaaaagaacggttttagctgccagatcgaaaccagt
ggtactcatgaggtacgctgcacaccgaatacctgggttaccgtatcgccaaagctgaac
atgcgcggcggctatgaagtgttgtcacaggcactggagcgagccaacgaaatcaagcat
ccagtggggcgcgtacgcgatattgaagcactggatgaactactggcaacgctgaccgat
gataaaccgcgagtcattgcactgcagccgattagccaaaaggatgatgccacacgtttg
tgcattgaaacctgcattgcgcgtaattggcgtttgtcgatgcaaacacataaatatcta
aatattgcctga

DBGET integrated database retrieval system