KEGG   Escherichia coli K-12 MG1655: b2889Help
Entry
b2889             CDS       T00007                                 

Gene name
idi
Definition
(RefSeq) isopentenyl diphosphate isomerase (EC:5.3.3.2)
  KO
K01823  
isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    b2889 (idi)
Enzymes [BR:eco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     b2889 (idi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3033065..3033613
Genome map
AA seq 182 aa AA seqDB search
MQTEHVILLNAQGVPTGTLEKYAAHTADTRLHLAFSSWLFNAKGQLLVTRRALSKKAWPG
VWTNSVCGHPQLGESNEDAVIRRCRYELGVEITPPESIYPDFRYRATDPSGIVENEVCPV
FAARTTSALQINDDEVMDYQWCDLADVLHGIDATPWAFSPWMVMQATNREARKRLSAFTQ
LK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacggaacacgtcattttattgaatgcacagggagttcccacgggtacgctggaa
aagtatgccgcacacacggcagacacccgcttacatctcgcgttctccagttggctgttt
aatgccaaaggacaattattagttacccgccgcgcactgagcaaaaaagcatggcctggc
gtgtggactaactcggtttgtgggcacccacaactgggagaaagcaacgaagacgcagtg
atccgccgttgccgttatgagcttggcgtggaaattacgcctcctgaatctatctatcct
gactttcgctaccgcgccaccgatccgagtggcattgtggaaaatgaagtgtgtccggta
tttgccgcacgcaccactagtgcgttacagatcaatgatgatgaagtgatggattatcaa
tggtgtgatttagcagatgtattacacggtattgatgccacgccgtgggcgttcagtccg
tggatggtgatgcaggcgacaaatcgcgaagccagaaaacgattatctgcatttacccag
cttaaataa

DBGET integrated database retrieval system