KEGG   Escherichia coli K-12 MG1655: b3359Help
Entry
b3359             CDS       T00007                                 

Gene name
argD
Definition
(RefSeq) bifunctional acetylornithine aminotransferase and succinyldiaminopimelate aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00220  Arginine biosynthesis
eco00300  Lysine biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01210  2-Oxocarboxylic acid metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
eco_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    b3359 (argD)
   00220 Arginine biosynthesis
    b3359 (argD)
Enzymes [BR:eco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     b3359 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     b3359 (argD)
Amino acid related enzymes [BR:eco01007]
 Aminotransferase (transaminase)
  Class III
   b3359 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 947864
NCBI-ProteinID: NP_417818
Pasteur: argD
RegulonDB: ECK120000062
ECOCYC: EG10066
ASAP: ABE-0010976
UniProt: P18335
Position
complement(3488960..3490180)
Genome map
AA seq 406 aa AA seqDB search
MAIEQTAITRATFDEVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCH
PALVNALKTQGETLWHISNVFTNEPALRLGRKLIEATFAERVVFMNSGTEANETAFKLAR
HYACVRHSPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVK
AVMDDHTCAVVVEPIQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFA
YMHYGVTPDILTSAKALGGGFPISAMLTTAEIASAFHPGSHGSTYGGNPLACAVAGAAFD
IINTPEVLEGIQAKRQRFVDHLQKIDQQYDVFSDIRGMGLLIGAELKPQYKGRARDFLYA
GAEAGVMVLNAGPDVMRFAPSLVVEDADIDEGMQRFAHAVAKVVGA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgaacaaacagcaattacacgcgcgactttcgatgaagtgatcctgccgatt
tatgctccggcagagtttattccggtaaaaggtcagggcagccgaatctgggatcagcaa
ggcaaggagtatgtcgatttcgcgggtggcattgcagttacggcgttgggccattgccat
cctgcgctggtgaacgcgttaaaaacccagggcgaaactctgtggcatatcagtaacgtt
ttcaccaatgaaccggcgctgcgtcttgggcgtaaactgattgaggcaacgtttgccgaa
cgcgtggtgtttatgaactccggcacggaagctaacgaaaccgcctttaaactggcacgc
cattacgcctgtgtgcgtcatagcccgttcaaaaccaaaattattgccttccataacgct
tttcatggtcgctcgctgtttaccgtttcggtgggtgggcagccaaaatattccgacggc
tttgggccgaaaccggcagacatcatccacgttccctttaacgatctccatgcagtgaaa
gcggtgatggatgatcacacctgtgcggtggtggttgagccgatccagggcgagggcggt
gtgacggcagcgacgccagagtttttgcagggcttgcgcgagctgtgcgatcaacatcag
gcattattggtgtttgatgaagtgcagtgcgggatggggcggaccggcgatttgtttgct
tacatgcactacggcgttacgccggatattctgacctctgcgaaagcgttaggcggcggc
ttcccgattagcgccatgctgaccacggcggaaattgcttctgcgtttcatcctggttct
cacggttccacctacggcggtaatcctctggcctgtgcagtagcgggggcggcgtttgat
atcatcaatacccctgaagtgctggaaggcattcaggcgaaacgccagcgttttgttgac
catctgcagaagatcgatcagcagtacgatgtatttagcgatattcgcggtatggggctg
ttgattggcgcagagctgaaaccacagtacaaaggtcgggcgcgtgatttcctgtatgcg
ggcgcagaggctggcgtaatggtgctgaatgccggaccggatgtgatgcgttttgcaccg
tcgctggtggtggaagatgcggatatcgatgaagggatgcaacgtttcgcccacgcggtg
gcgaaggtggttggggcgtaa

DBGET integrated database retrieval system