KEGG   Escherichia coli K-12 MG1655: b3599Help
Entry
b3599             CDS       T00007                                 

Gene name
mtlA
Definition
(RefSeq) fused mannitol-specific PTS enzymes: IIA components/IIB components/IIC components (EC:2.7.1.69)
  KO
K02798  
PTS system, mannitol-specific IIA component [EC:2.7.1.197]
K02799  
PTS system, mannitol-specific IIB component [EC:2.7.1.197]
K02800  
PTS system, mannitol-specific IIC component
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Fructose and mannose metabolism
Phosphotransferase system (PTS)
Module
PTS system, mannitol-specific II component
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    b3599 (mtlA)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b3599 (mtlA)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.197  protein-Npi-phosphohistidine---D-mannitol phosphotransferase
     b3599 (mtlA)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannitol-specific II component [MD:M00274]
    b3599 (mtlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3772281..3774194
Genome map
AA seq 637 aa AA seqDB search
MSSDIKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPNETLAKLVGPMITYLL
PLLIGYTGGKLVGGERGGVVGAITTMGVIVGADMPMFLGSMIAGPLGGWCIKHFDRWVDG
KIKSGFEMLVNNFSAGIIGMILAILAFLGIGPIVEALSKMLAAGVNFMVVHDMLPLASIF
VEPAKILFLNNAINHGIFSPLGIQQSHELGKSIFFLIEANPGPGMGVLLAYMFFGRGSAK
QSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILGGGLVSPASPGSI
LAVLAMTPKGAYFANIAGVCAAMAVSFVVSAILLKTSKVKEEDDIEAATRRMQDMKAESK
GASPLSAGDVTNDLSHVRKIIVACDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNL
PPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRHTANEEKVKD
SLKDSFDDSSANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREK
LTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEH
IQVITSLTNALDDESVIERLAHTTSVDEVLELLAGRK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgatattaagatcaaagtgcaaagctttggtcgtttcctcagcaacatggtg
atgccaaatatcggcgcgtttatcgcgtggggtatcatcaccgcgttatttattccaaca
gggtggttaccgaacgagacgctggcgaagctggtcgggccgatgatcacttatctcctg
ccgctgctgatcggttataccggtggtaagctggtaggcggcgaacgtggcggcgtagtc
ggtgccatcaccaccatgggcgttatcgtcggcgcagacatgccgatgttcctcggttct
atgattgcaggtccgctgggcggctggtgcattaagcacttcgaccgctgggtagacggt
aagatcaaatccggttttgagatgctggtgaataacttctccgcaggcatcatcgggatg
atcctcgctattctggcattcctcggcattggcccgattgttgaagccctgtccaaaatg
ctggctgcgggcgttaacttcatggttgtccatgacatgctgccgctggcgtctatcttt
gttgaaccggcgaaaatcctgttcctcaacaacgccattaaccacggtatcttctcgccg
ctgggtattcagcagtcccatgaactgggtaaatcaatcttcttcctgattgaagctaac
ccaggtccaggtatgggcgtgctgctggcgtacatgttctttggtcgtggtagcgctaaa
cagtctgcgggcggtgcggcaatcatccacttcctggggggtatccacgaaatctacttc
ccgtatgtgctgatgaatccgcgtctgatcctcgcagtcatcctcggcggtatgactggc
gtgttcacgctgactatcctgggcggtggtctggtttctccggcatctccgggttctatc
cttgctgtactggcgatgacaccaaaaggtgcttacttcgctaacatcgcgggtgtgtgt
gcggcgatggctgtctccttcgttgtctctgctattttgctgaaaaccagcaaagtgaaa
gaagaagatgatattgaagcagcaactcgtcgtatgcaggacatgaaagctgagtctaaa
ggcgcatctccgctgtctgctggcgatgtgactaacgacctgagccacgtacgtaaaatc
atcgttgcctgtgacgccggtatgggttccagtgcgatgggcgcaggcgttctgcgtaag
aaaattcaggatgcaggtctgtcgcagatttctgttactaacagcgcgatcaacaacctg
ccgccagatgtggacctcgtcatcactcaccgtgacctgaccgaacgcgctatgcgccag
gttccgcaggcacagcatatttcgctgaccaacttcctcgacagcggcctgtacaccagc
ctgaccgaacgtctggttgctgcccaacgccacacggcaaacgaagagaaagtaaaagac
agcctgaaagacagctttgacgattccagtgctaacctgttcaagctaggcgcggagaac
atcttcctcggtcgcaaagcggcaaccaaagaagaagcgattcgttttgctggcgagcag
ctggtgaaaggcggttacgttgagccggaatacgttcaggcgatgctggatcgtgaaaaa
ctgaccccgacttatctgggtgagtctatcgcggtgccacacggtacggttgaagcgaaa
gatcgcgtactgaaaacgggcgtcgtgttctgccagtacccggaaggcgtgcgcttcggt
gaagaagaagatgacattgcccgtctggtgattggtattgctgcccgtaacaacgagcac
attcaggttatcaccagcctgaccaatgcactggatgatgagtccgtcatcgagcgtctg
gcacacaccaccagcgtggatgaagtgctggaactgctggcaggtcgtaagtaa

DBGET integrated database retrieval system