KEGG   Escherichia coli K-12 MG1655: b3704Help
Entry
b3704             CDS       T00007                                 

Gene name
rnpA
Definition
(RefSeq) protein C5 component of RNase P (EC:3.1.26.5)
  KO
K03536  
ribonuclease P protein component [EC:3.1.26.5]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     b3704 (rnpA)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  5'processing factors
   Ribonucrease P
    b3704 (rnpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3884493..3884852
Genome map
AA seq 119 aa AA seqDB search
MVKLAFPRELRLLTPSQFTFVFQQPQRAGTPQITILGRLNSLGHPRIGLTVAKKNVRRAH
ERNRIKRLTRESFRLRQHELPAMDFVVVAKKGVADLDNRALSEALEKLWRRHCRLARGS
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtggttaagctcgcatttcccagggagttacgcttgttaactcccagtcaattcacattc
gtcttccagcagccacaacgggctggcacgccgcaaattaccattctcggccgcctgaat
tcgctggggcatccccgtatcggtcttacagtcgccaagaaaaacgttcgacgcgcccat
gaacgcaatcggattaaacgtctgacgcgtgaaagcttccgtctgcgccaacatgaactc
ccggctatggatttcgtggtggtggcgaaaaaaggggttgccgacctcgataaccgtgct
ctctcggaagcgttggaaaaattatggcgccgccactgtcgcctggctcgcgggtcctga

DBGET integrated database retrieval system