KEGG   Escherichia coli K-12 MG1655: b3919Help
Entry
b3919             CDS       T00007                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00051  Fructose and mannose metabolism
eco00562  Inositol phosphate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eco_M00002  Glycolysis, core module involving three-carbon compounds
eco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b3919 (tpiA)
   00051 Fructose and mannose metabolism
    b3919 (tpiA)
   00562 Inositol phosphate metabolism
    b3919 (tpiA)
Enzymes [BR:eco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     b3919 (tpiA)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   b3919 (tpiA)
  Exosomal proteins of bladder cancer cells
   b3919 (tpiA)
  Exosomal proteins of melanoma cells
   b3919 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 948409
NCBI-ProteinID: NP_418354
Pasteur: tpiA
RegulonDB: ECK120001004
ECOCYC: EG11015
ASAP: ABE-0012799
UniProt: P0A858
Structure
PDB: 

Jmol
Position
complement(4110740..4111507)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtatatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggtcactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaatgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccggatatcgacggcgcgctggttggtggtgcttctctgaaagctgac
gccttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system