KEGG   Escherichia coli K-12 MG1655: b3925Help
Entry
b3925             CDS       T00007                                 

Gene name
glpX
Definition
(RefSeq) fructose 1,6-bisphosphatase II (EC:3.1.3.11)
  KO
K02446  
fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b3925 (glpX)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b3925 (glpX)
   00030 Pentose phosphate pathway
    b3925 (glpX)
   00051 Fructose and mannose metabolism
    b3925 (glpX)
  Energy metabolism
   00680 Methane metabolism
    b3925 (glpX)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     b3925 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4114569..4115579)
Genome map
AA seq 336 aa AA seqDB search
MRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEI
DEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYM
EKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVR
VFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKG
DNEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNI
ATTETLLIRGKSRTIRRIQSIHYLDRKDPEMQVHIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagaacttgccatcgaattttcccgcgtcaccgaatcagcggcgctggctggc
tacaaatggttaggacgcggcgataaaaacaccgcggacggcgcggcggtaaacgccatg
cgtattatgctcaaccaggtcaacattgacggcaccatcgtcattggtgaaggtgaaatc
gacgaagcaccgatgctctacattggtgaaaaagtcggtactggtcgcggcgacgcggta
gatattgctgttgatccgattgaaggcacgcgcatgacggcgatgggccaggctaacgcg
ctggcggtgctggcagtaggcgataaaggctgcttcctcaatgcgccggatatgtatatg
gagaagctgattgtcgggccgggagccaaaggcaccattgatctgaacctgccgctggcg
gataacctgcgcaatgtagcggcggcgctcggcaaaccgttgagcgaactgacggtaacg
attctggctaaaccacgccacgatgccgttatcgctgaaatgcagcaactcggcgtacgc
gtatttgctattccggacggcgacgttgcggcctcaattctcacctgtatgccagacagc
gaagttgacgtgctgtacggtattggtggcgcgccggaaggcgtagtttctgcggcggtg
atccgcgcattagatggcgacatgaacggtcgtctgctggcgcgtcatgacgtcaaaggc
gacaacgaagagaatcgtcgcattggcgagcaggagctggcacgctgcaaagcgatgggc
atcgaagccggtaaagtattgcgcctgggcgatatggcgcgcagcgataacgtcatcttc
tctgccaccggtattaccaaaggcgatctgctggaaggcattagccgcaaaggcaatatc
gcgactaccgaaacgctgctgatccgcggcaagtcacgcaccattcgccgcattcagtcc
atccactatctggatcgcaaagacccggaaatgcaggtgcacatcctctga

DBGET integrated database retrieval system