KEGG   Escherichia coli K-12 MG1655: b3959Help
Entry
b3959             CDS       T00007                                 

Gene name
argB
Definition
(RefSeq) acetylglutamate kinase
  KO
K00930  
acetylglutamate kinase [EC:2.7.2.8]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    b3959 (argB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     b3959 (argB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4156013..4156789
Genome map
AA seq 258 aa AA seqDB search
MMNPLIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLPVK
KKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHQIAAVGLFLGDGDSVKVTQLDEELG
HVGLAQPGSPKLINSLLENGYLPVVSSIGVTDEGQLMNVNADQAATALAATLGADLILLS
DVSGILDGKGQRIAEMTAAKAEQLIEQGIITDGMIVKVNAALDAARTLGRPVDIASWRHA
EQLPALFNGMPMGTRILA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatccattaattatcaaactgggcggcgtactgctggatagtgaagaggcgctg
gaacgtctgtttagcgcactggtgaattatcgtgagtcacatcagcgtccgctggtgatt
gtgcacggcggcggttgcgtggtggatgagctgatgaaagggctgaatctgccggtgaaa
aagaaaaacggcctgcgggtgacgcctgctgatcagatagacattatcaccggagcactg
gcgggaacggcaaataaaaccctgttggcatgggcgaagaaacatcagattgcggccgta
ggtttgtttctcggtgacggcgacagcgtcaaagtgacccagcttgatgaagagttaggt
catgttggactggcgcagccaggttcgcctaagcttatcaactccttgctggagaacggt
tatctgccggtggtcagctccattggcgtaacagacgaagggcaactgatgaacgtcaat
gccgaccaggcggcaacggcgctggcggcaacgctgggcgcggatctgattttgctctcc
gacgtcagcggcattctcgacggcaaagggcaacgcattgccgaaatgaccgccgcgaaa
gcagaacaactgattgagcagggcattattactgacggcatgatagtgaaagtgaacgcg
gcgctggatgcggcccgcacgctgggccgtccggtagatatcgcctcctggcgtcatgcg
gagcagcttccggcactgtttaacggtatgccgatgggtacgcggattttagcttaa

DBGET integrated database retrieval system