KEGG   Escherichia coli K-12 MG1655: b3960Help
Entry
b3960             CDS       T00007                                 

Gene name
argH
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b3960 (argH)
   00220 Arginine biosynthesis
    b3960 (argH)
Enzymes [BR:eco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     b3960 (argH)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   b3960 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4156850..4158223
Genome map
AA seq 457 aa AA seqDB search
MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEE
ALNVLLEDVRARPQQILESDAEDIHSWVEGKLIDKVGQLGKKLHTGRSRNDQVATDLKLW
CKDTVSELLTANRQLQSALVETAQNNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDE
SRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELLS
AAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQ
GALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMAALVLDGIQVKRPRCQEAA
QQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKFSQVIDED
VYPILSLQSCLDKRAAKGGVSPQQVAQAIAFAQARLG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcactttggggcgggcgttttacccaggcagcagatcaacggttcaaacaattcaac
gactcactgcgctttgattaccgtctggcggagcaggatattgttggctctgtggcctgg
tccaaagccctggtcacggtaggcgtgttaaccgcagaagagcaggcgcaactggaagag
gcgctgaacgtgttgctggaagatgttcgcgccaggccacaacaaatccttgaaagcgac
gccgaagatatccatagctgggtggaaggcaaactgatcgacaaagtgggccagttaggc
aaaaagctgcataccgggcgtagccgtaatgatcaggtagcgactgacctgaaactgtgg
tgcaaagataccgttagcgagttactgacggctaaccggcagctgcaatcggcgctggtg
gaaaccgcacaaaacaatcaggacgcggtaatgccaggttacactcacctgcaacgcgcc
cagccggtgacgttcgcgcactggtgcctggcctatgttgagatgctggcgcgtgatgaa
agccgtttgcaggatgcgcttaagcgtctggatgtcagcccgctaggctgtggcgcgctg
gcgggaacggcctatgaaatcgaccgtgaacagttagcaggctggctgggctttgcttcg
gcgacccgtaacagtctcgacagcgtttctgaccgtgaccatgtgttggaactgctttct
gctgccgctatcggcatggtgcatctgtcgcgttttgctgaagatctgattttctttaac
accggcgaagcggggtttgtggagctttctgaccgcgtgacttccggttcatcattaatg
ccgcagaagaaaaacccggatgcgctggagctgattcgcggtaaatgcggccgggtgcag
ggggcgttaaccggcatgatgatgacgctgaaaggtttgccgctggcttacaacaaagat
atgcaggaagacaaagaaggtctgttcgacgcgctcgatacctggctggactgcctgcat
atggcggcgctggtgctggacggcattcaggtgaaacgtccacgttgccaggaagcggct
cagcagggttacgccaacgccaccgaactggcggattatctggtggcgaaaggcgtaccg
ttccgcgaggcgcaccatattgttggtgaagcggtggtggaagccattcgtcagggcaaa
ccgctggaagatctgccgctcagtgagttgcagaaattcagtcaggtgattgacgaagat
gtctatccgattctgtcgctgcaatcgtgcctcgacaagcgtgcggcaaaaggcggcgtc
tcaccgcagcaggtggcgcaggcgattgcttttgcgcaggctcggttagggtaa

DBGET integrated database retrieval system